KEGG   Solibacillus silvestris: SSIL_1181Help
Entry
SSIL_1181         CDS       T02162                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
siv  Solibacillus silvestris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSIL_1181
   01230 Biosynthesis of amino acids
    SSIL_1181
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_1181
   00030 Pentose phosphate pathway
    SSIL_1181
   00051 Fructose and mannose metabolism
    SSIL_1181
   00052 Galactose metabolism
    SSIL_1181
  Energy metabolism
   00680 Methane metabolism
    SSIL_1181
Enzymes [BR:siv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSIL_1181
Protein phosphatases and associated proteins [BR:siv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSIL_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1293218..1294177
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAVIRAVVRKARFHNVDVVGVYHGYEGLYNGNFELLDIGSVGDI
IQRGGTKLYSARFPEFKQDDIQYRAIERMKEEGIEGLVVIGGDGTYRGAMQLTDKGFPCV
GIPGTIDNDVPGTEYTIGFDTALNTVVESIDKIRDTATSHENTFVIEVMGRDAGDIALWA
GLAAGAESILIPEEAYDLDDIVTRLERGVARGKRHSIIIVAEGVMNGHKLANLLEERTGI
KIRTSVLGHIQRGGSPSARDRVLAGRFGARAVELLLENKGGRAVGVKNHAIIDYDLRKAF
ETKHQADLSLYTLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgcggttttaacgagtggtggagacgcacctggaatgaatgctgttatt
cgtgcagtcgttcgtaaagcgcgttttcataatgttgatgttgtcggtgtatatcatggt
tatgaaggactctataatgggaactttgaacttttagatattggttctgttggcgatatt
attcaaagaggcggaacgaaactgtattcagcacgtttccctgaatttaagcaggatgat
atacaatatagagcaatcgaacgcatgaaagaagagggaatcgaaggtttagtcgtcatt
ggcggagatggtacttatcgtggagcaatgcaattaactgataaaggattcccgtgtgtg
ggtattccgggtacaatcgacaatgatgtacccggtacagaatatacgattggctttgat
acagcactgaatacagtcgttgaatcgatcgataaaatccgagatacggcaacaagtcat
gaaaatacgtttgttattgaagtaatgggccgcgacgcaggagacattgctctttgggca
ggtttggcagctggtgcagaatcgattttaataccggaagaggcgtatgatctggatgat
attgttacacgtcttgagcgtggagtagctcgtggaaagcgccacagtattattattgta
gctgaaggtgtaatgaatggtcataaactggcgaaccttttagaagaacgcacagggatt
aaaattcggacatcggtattaggtcatatacaacgaggagggtctccatcggctcgggac
cgcgttttagcaggaagatttggtgcaagagcggtagagctattgttggaaaacaaaggt
ggtagagcagttggcgtgaaaaatcacgctataatcgattatgatttaagaaaagcattt
gaaactaagcaccaggcagatttaagtttgtatacattatcaaaagagctttcaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system