KEGG   Solibacillus silvestris: SSIL_1253Help
Entry
SSIL_1253         CDS       T02162                                 

Definition
enoyl-CoA hydratase/carnithine racemase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
siv  Solibacillus silvestris
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SSIL_1253
  Lipid metabolism
   00071 Fatty acid degradation
    SSIL_1253
Enzymes [BR:siv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SSIL_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1374162..1374935
Genome map
AA seq 257 aa AA seqDB search
MEFLSWKVEEGVAIATISRPPANALSQGLIHDVNALLDAVEEDGNVRVIVLHGEGRFFSA
GADIKEFTSVQSGEAFTGLAKNGQDVFERIETFSKPVIAAIHGAALGGGLELAMGCHMRF
VTASAKLGLPELSLGLIPGFAGTQRLPRYVGVAKAAEMMFTSDPITGAEAVEWGLANRAF
PDEELLPETLKIARKIAKKSPIALKAAIQMLNYSKPSSYYDGVNAEANSFGEVFVSEDAK
EGIQAFIEKREPVFTGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagtttctaagttggaaagtagaagaaggggtcgcaattgcaacaatttcaagacca
ccagcaaatgcactttcacaaggcttgatccatgatgtgaatgcacttttagacgctgtc
gaagaagatggaaatgtacgtgtcatcgtcttgcatggcgaaggacgtttcttttctgca
ggtgcagatattaaagaatttacgagcgtacagtcaggcgaagcatttacaggattggcg
aaaaatggacaagatgttttcgaacgtattgaaacattcagtaaaccggttattgccgca
atccacggtgcagcattaggaggcggcttggaacttgcgatgggatgccatatgcgcttt
gtaaccgcatcggcaaaattaggcttacctgagctatcattaggcttaatacctggattt
gcaggaacacagcgattaccacgatatgttggtgtagccaaagctgcggaaatgatgttt
acaagcgacccgattacaggggctgaagctgtagaatggggattagcaaaccgtgctttt
cccgacgaagagctgttgccggaaacattgaaaatcgctagaaaaattgcgaagaaatca
ccaattgctcttaaagcagcaatccaaatgctgaattactcgaaaccatcatcttattac
gatggagtaaatgctgaagcaaacagtttcggtgaggtatttgtttctgaagatgctaaa
gaaggaatccaagcatttattgaaaaacgtgagccagtatttactggcaaataa

DBGET integrated database retrieval system