KEGG   Solibacillus silvestris: SSIL_1482Help
Entry
SSIL_1482         CDS       T02162                                 

Definition
holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
siv  Solibacillus silvestris
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:siv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSIL_1482
Enzymes [BR:siv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SSIL_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1574475..1575230
Genome map
AA seq 251 aa AA seqDB search
MLDGEEYDKLLKAVLKDGLFFLNQHTFGNSQLLCYNRARNVRDKTMYDYLKGQVTRVTPE
YIVLEQQGIGWMLYTPNPFAFRTSASEQQIYVSLQVREDAQNLYGFNSLEQRELFKKLIQ
VSGIGPKGALAILASGNPTSVIQAIEMEDEAFLIRFPGVGKKTARQMILDLKGKLDMLLD
HVELPSAENELPLFGVNPNEHELQEAMLALVALGYSEKELDKIRPQLSEDDKLTTTDAYI
KQALKLLLKLK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgttagatggagaagaatatgataaactattaaaggctgtcttaaaggacggtcttttc
tttttgaaccaacatacgttcggtaattcacagctcttatgctataatagagcgagaaat
gtgagggataaaacgatgtatgattatttaaaaggacaggttacaagggttacacccgag
tatattgtattagagcaacaaggcattggctggatgctgtatacgccaaatccatttgca
ttccgtacatctgcaagcgaacagcaaatatatgtatccttgcaagtgcgtgaagatgcc
caaaatttatacgggttcaatagtttggagcagcgggaattatttaaaaagctaattcaa
gtatcgggcattggtccaaaaggcgcgcttgctattttagcgagcggtaatccgacttca
gtcattcaggcaattgaaatggaagatgaagcatttttaatccgtttcccgggcgtcggg
aaaaaaacagcacgtcaaatgattctcgatctaaaagggaagctggacatgctacttgat
cacgtcgagttaccaagtgcagaaaatgagctgccattgtttggagtgaatccgaatgaa
catgaattgcaggaagcgatgctggcacttgtcgcattaggctattcagaaaaggaatta
gacaaaatcagaccgcaattaagtgaagatgataagttaacgacgacagacgcctatatt
aaacaggcattgaagctgttgttgaaattgaaataa

DBGET integrated database retrieval system