KEGG   Solibacillus silvestris StLB046: SSIL_1500Help
Entry
SSIL_1500         CDS       T02162                                 

Definition
(GenBank) ATP-dependent exoDNAse alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:siv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSIL_1500
Enzymes [BR:siv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SSIL_1500
DNA repair and recombination proteins [BR:siv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SSIL_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA_22 T2SSE DUF2075 UvrD_C AAA_28 HHH_5 AAA_12 AAA TsaE NTPase_1 AAA_18 AAA_16 NACHT AAA_25 AAA_5 AAA_33 AAA_17
Motif
Other DBs
NCBI-ProteinID: BAK15923
UniProt: F2F3H5
Position
1592738..1595239
Genome map
AA seq 833 aa AA seqDB search
MEMAENLNLFDVNKLFILGRPIVTIFHNATNMYSIVRVKIQETNIQYDEKEIIIVGYFPQ
LVNDEQYRFTGQLKSHPKYGMQFQIDTFEKEVPTTEQGIVHYLSSDLFSGVGRKTAETIV
EKLGMDALTKILEDPSALDAVPRLSAEKKLHIRQTIEENLGLERVMVRLNDWGFGPQLGM
KIYQAYREETIQLLTENPYRLIEEVEGVGFIRADELGAKLGITGNHPDRIKAAIFHVLTN
AALSEGHVYLDAEMVLPMVKDMLEQSQRIEIPYEAISKAAIDMREESKICGEETRMYLPS
LYFSEVGIASKINELKEKNKTAESFTKDEIRKAIGDIEEQYDVTYAPTQAQAIETAINSA
VMILTGGPGTGKTTVVRGLVEVYAELHGLSLNPKTYAEKEEPFPIVLAAPTGRAAKRLAE
STGLPAMTIHRLLGFNGQEKDEETEREVVGRLIIIDEMSMVDTWLAHQLLKALHEDVQVV
FVGDQDQLPPVGPGQVLKDLLASKQIPTVELTDIYRQAEGSTIIEMAHQIKKGKVPDTLT
AKTTDRSFIQAGAAQVTSVVTQIVKGALAKGQAIRDIQVLAPMYKGPAGIDNLNKEIQQL
VNPNDGTRKELVFGDTIYRIGDKVLQLVNQPDNNVFNGDMGEVISIIRAKETVEKQDLLI
VSYDGIEVTYQRADLNQITLAYCCSIHKSQGSEFQTVIMPIVRGYSKMLRRNLLYTGITR
AKNFLILCGEPDVLASGLAKTDDLTRLTTLKARLNSEFVAEEKMEATPELEEKKAPVSEV
KQIPSSEQLGLLNVSASHKIGESLPNHLTAETAPYIHPLIGMANISPYDFNEE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcggaaaatctaaatttgtttgacgtaaataagctctttattttaggtcga
ccgattgtaacaatttttcataatgcaacgaatatgtactccattgttcgtgtcaaaatt
caagaaacaaacattcagtatgacgaaaaagaaatcatcattgttggctacttcccgcaa
ttagtcaatgatgaacaataccgctttacagggcagttaaaaagtcatccgaaatacggg
atgcaatttcaaattgatacatttgaaaaagaagtgccgacaaccgagcaaggaatcgtc
cattatttatcaagtgatctattttcaggtgtgggcagaaaaacggcagagacaattgta
gaaaagctcggtatggatgctcttacgaaaatactggaagatccgtcagcactcgatgct
gttccccggttatctgctgaaaaaaaattacatattcgccaaacgatcgaggaaaacctt
ggactggaacgggtgatggtgcggctgaatgattggggctttgggccacagcttgggatg
aaaatttaccaggcttatcgggaagaaacaattcagttactgacagaaaacccttaccgt
ttaatcgaggaagtggaaggggtcggttttatacgtgccgatgaacttggtgcgaagctg
ggtattacgggaaatcacccggatcgaataaaggctgccattttccatgtactgacaaat
gccgcattatcagaaggacatgtttatttggatgcggaaatggtgcttccaatggttaaa
gatatgcttgaacaaagtcagcgcatcgaaatcccgtatgaagcgatttcgaaagcggca
atcgatatgcgtgaggaatcgaaaatttgcggcgaggaaacacgcatgtacttaccgtca
ctctattttagtgaagtgggtattgcaagtaagatcaatgaactgaaagaaaaaaacaaa
acagctgaaagttttacgaaagatgaaatccgaaaagcaattggcgatattgaagaacaa
tatgatgtgacgtatgcgccaacacaggcacaggcaattgaaacggcaatcaattctgcc
gtcatgattttaacaggaggacccggcacgggaaaaacaaccgttgtacgaggtttggtg
gaagtatatgcggaacttcacgggttatcattaaatccaaaaacatatgctgaaaaagag
gaaccgtttcccattgtccttgcagccccaacaggacgtgcagcgaaaagactggcggaa
tcgactggcttacctgctatgacaatacacaggctgttaggctttaatggtcaggaaaag
gatgaagaaacagagcgtgaagtcgtaggtcgtctcattattatcgatgaaatgtcgatg
gttgatacatggctggcacatcaactgttaaaagcattgcatgaagatgttcaagtcgtt
tttgtaggggatcaagatcagttaccgcctgtcggtccagggcaagtcttaaaggatttg
cttgcatccaaacaaattccgactgtcgaattaacagatatataccgtcaagcggaaggt
tctacaattatcgagatggcccaccaaatcaaaaaaggcaaagttccggatacgttgact
gcaaaaacaacggaccgctcgtttatacaagctggagctgcacaagtaacgagtgttgtc
acacagattgtaaaaggtgcacttgcgaagggacaggcaattcgagatattcaagtattg
gcgccaatgtacaaaggacctgcaggcatcgataatttaaataaagaaatccagcagctc
gtcaatccgaatgatgggacgagaaaagaacttgtttttggtgatacgatttatcgtata
ggggacaaagtgctgcagctagtgaatcagccggataataatgtattcaacggggatatg
ggagaagtaatttccatcatccgtgcaaaggaaacagtggaaaagcaggatttgcttatc
gtcagctatgatgggatcgaagtaacatatcagcgtgctgatttaaatcagattacattg
gcctattgctgttcgatccataaatcgcaaggctctgaatttcaaacggtcattatgccg
attgttcgcggctattcgaaaatgcttcgaagaaatttactgtatacaggtattacacgt
gctaaaaactttttaatattatgtggtgagccggatgtactggcgagcggtttagcaaaa
acagatgatttaacacgcttaacaacattgaaggcacgtttaaattcagaatttgttgct
gaagaaaagatggaagcgacaccggaattggaagagaaaaaggcgcctgtaagtgaagtg
aaacaaattccttcatcagagcagctcggcctcttgaatgtttcggcttcacataagatc
ggggaatccctgccaaatcacttaacggcagaaacagcaccatatattcacccattaatt
ggtatggcaaatatatcgccgtatgatttcaacgaagaatag

DBGET integrated database retrieval system