KEGG   Solibacillus silvestris: SSIL_1500Help
Entry
SSIL_1500         CDS       T02162                                 

Definition
ATP-dependent exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
siv  Solibacillus silvestris
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:siv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSIL_1500
Enzymes [BR:siv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SSIL_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1592738..1595239
Genome map
AA seq 833 aa AA seqDB search
MEMAENLNLFDVNKLFILGRPIVTIFHNATNMYSIVRVKIQETNIQYDEKEIIIVGYFPQ
LVNDEQYRFTGQLKSHPKYGMQFQIDTFEKEVPTTEQGIVHYLSSDLFSGVGRKTAETIV
EKLGMDALTKILEDPSALDAVPRLSAEKKLHIRQTIEENLGLERVMVRLNDWGFGPQLGM
KIYQAYREETIQLLTENPYRLIEEVEGVGFIRADELGAKLGITGNHPDRIKAAIFHVLTN
AALSEGHVYLDAEMVLPMVKDMLEQSQRIEIPYEAISKAAIDMREESKICGEETRMYLPS
LYFSEVGIASKINELKEKNKTAESFTKDEIRKAIGDIEEQYDVTYAPTQAQAIETAINSA
VMILTGGPGTGKTTVVRGLVEVYAELHGLSLNPKTYAEKEEPFPIVLAAPTGRAAKRLAE
STGLPAMTIHRLLGFNGQEKDEETEREVVGRLIIIDEMSMVDTWLAHQLLKALHEDVQVV
FVGDQDQLPPVGPGQVLKDLLASKQIPTVELTDIYRQAEGSTIIEMAHQIKKGKVPDTLT
AKTTDRSFIQAGAAQVTSVVTQIVKGALAKGQAIRDIQVLAPMYKGPAGIDNLNKEIQQL
VNPNDGTRKELVFGDTIYRIGDKVLQLVNQPDNNVFNGDMGEVISIIRAKETVEKQDLLI
VSYDGIEVTYQRADLNQITLAYCCSIHKSQGSEFQTVIMPIVRGYSKMLRRNLLYTGITR
AKNFLILCGEPDVLASGLAKTDDLTRLTTLKARLNSEFVAEEKMEATPELEEKKAPVSEV
KQIPSSEQLGLLNVSASHKIGESLPNHLTAETAPYIHPLIGMANISPYDFNEE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcggaaaatctaaatttgtttgacgtaaataagctctttattttaggtcga
ccgattgtaacaatttttcataatgcaacgaatatgtactccattgttcgtgtcaaaatt
caagaaacaaacattcagtatgacgaaaaagaaatcatcattgttggctacttcccgcaa
ttagtcaatgatgaacaataccgctttacagggcagttaaaaagtcatccgaaatacggg
atgcaatttcaaattgatacatttgaaaaagaagtgccgacaaccgagcaaggaatcgtc
cattatttatcaagtgatctattttcaggtgtgggcagaaaaacggcagagacaattgta
gaaaagctcggtatggatgctcttacgaaaatactggaagatccgtcagcactcgatgct
gttccccggttatctgctgaaaaaaaattacatattcgccaaacgatcgaggaaaacctt
ggactggaacgggtgatggtgcggctgaatgattggggctttgggccacagcttgggatg
aaaatttaccaggcttatcgggaagaaacaattcagttactgacagaaaacccttaccgt
ttaatcgaggaagtggaaggggtcggttttatacgtgccgatgaacttggtgcgaagctg
ggtattacgggaaatcacccggatcgaataaaggctgccattttccatgtactgacaaat
gccgcattatcagaaggacatgtttatttggatgcggaaatggtgcttccaatggttaaa
gatatgcttgaacaaagtcagcgcatcgaaatcccgtatgaagcgatttcgaaagcggca
atcgatatgcgtgaggaatcgaaaatttgcggcgaggaaacacgcatgtacttaccgtca
ctctattttagtgaagtgggtattgcaagtaagatcaatgaactgaaagaaaaaaacaaa
acagctgaaagttttacgaaagatgaaatccgaaaagcaattggcgatattgaagaacaa
tatgatgtgacgtatgcgccaacacaggcacaggcaattgaaacggcaatcaattctgcc
gtcatgattttaacaggaggacccggcacgggaaaaacaaccgttgtacgaggtttggtg
gaagtatatgcggaacttcacgggttatcattaaatccaaaaacatatgctgaaaaagag
gaaccgtttcccattgtccttgcagccccaacaggacgtgcagcgaaaagactggcggaa
tcgactggcttacctgctatgacaatacacaggctgttaggctttaatggtcaggaaaag
gatgaagaaacagagcgtgaagtcgtaggtcgtctcattattatcgatgaaatgtcgatg
gttgatacatggctggcacatcaactgttaaaagcattgcatgaagatgttcaagtcgtt
tttgtaggggatcaagatcagttaccgcctgtcggtccagggcaagtcttaaaggatttg
cttgcatccaaacaaattccgactgtcgaattaacagatatataccgtcaagcggaaggt
tctacaattatcgagatggcccaccaaatcaaaaaaggcaaagttccggatacgttgact
gcaaaaacaacggaccgctcgtttatacaagctggagctgcacaagtaacgagtgttgtc
acacagattgtaaaaggtgcacttgcgaagggacaggcaattcgagatattcaagtattg
gcgccaatgtacaaaggacctgcaggcatcgataatttaaataaagaaatccagcagctc
gtcaatccgaatgatgggacgagaaaagaacttgtttttggtgatacgatttatcgtata
ggggacaaagtgctgcagctagtgaatcagccggataataatgtattcaacggggatatg
ggagaagtaatttccatcatccgtgcaaaggaaacagtggaaaagcaggatttgcttatc
gtcagctatgatgggatcgaagtaacatatcagcgtgctgatttaaatcagattacattg
gcctattgctgttcgatccataaatcgcaaggctctgaatttcaaacggtcattatgccg
attgttcgcggctattcgaaaatgcttcgaagaaatttactgtatacaggtattacacgt
gctaaaaactttttaatattatgtggtgagccggatgtactggcgagcggtttagcaaaa
acagatgatttaacacgcttaacaacattgaaggcacgtttaaattcagaatttgttgct
gaagaaaagatggaagcgacaccggaattggaagagaaaaaggcgcctgtaagtgaagtg
aaacaaattccttcatcagagcagctcggcctcttgaatgtttcggcttcacataagatc
ggggaatccctgccaaatcacttaacggcagaaacagcaccatatattcacccattaatt
ggtatggcaaatatatcgccgtatgatttcaacgaagaatag

DBGET integrated database retrieval system