KEGG   Solibacillus silvestris: SSIL_1695Help
Entry
SSIL_1695         CDS       T02162                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
siv  Solibacillus silvestris
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSIL_1695 (glpK)
Enzymes [BR:siv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SSIL_1695 (glpK)
Exosome [BR:siv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSIL_1695 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1778565..1780055
Genome map
AA seq 496 aa AA seqDB search
MEKYIMALDQGTTSSRAILFNKKGDIVHTAQQEFKQYFPKSGWVEHNAKEIWSSILSVIA
KVLSENNIQASQIEGVGITNQRETTVVWDRNTGEPVYNAIVWQSRQTAEICDSLKEAGHN
ELFRNKTGLLIDAYFSGTKVKWILDNVKGTREKAEAGDLLFGTIDTWIIWKLTEGAVHVT
DYSNASRTLMYNIYDLKWDEELLDILGVPASMLPEVKPSSEIYGEIAGNHFFGHRVPIAG
IAGDQQAALFGQACYEQGMVKNTYGTGCFMLMNTGEEAVKSEHGLLTTIAWGYDGKVTYA
LEGSIFVAGSAIQWLRDGLRMFRKSAESEAYAARVKDTDGVYVVPAFVGLGTPYWDSEVR
GAVFGLTRGTSKEQFIRATLESLAYQTRDVLSAMESDSGIDLRKLRVDGGAVMNDFLMQF
QSDILNVPVDRPSVNETTALGAAYLAGLAVGFWENLDEVQQHWQLNRQFEPTMDEEQRES
LFTGWHKAVKAAQAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatattatggcgttagatcagggcacgacgagttcacgtgccattttattc
aataaaaaaggggatatcgttcatacagcacaacaggaatttaaacaatatttcccgaaa
tcgggttgggttgagcataatgcaaaggaaatttggagttccattttatcggtaattgca
aaggtattatcggaaaataatattcaggcgtcacaaatcgaaggagtcgggattacaaac
caacgagaaacgactgttgtgtgggatagaaatacgggtgaaccggtatataatgccatc
gtatggcaatcacgccaaactgcggaaatttgtgattccttaaaggaagcggggcataat
gagctgttccgtaataaaaccggtttgctcatcgatgcttatttttccggtacgaaagta
aaatggatattagacaatgtaaaaggaacacgagaaaaagcggaagcgggtgacctttta
ttcggaacaattgatacatggattatttggaagcttacagaaggagctgttcatgtgacg
gactactcgaatgcttcccgaacattaatgtataatatttatgatttaaaatgggatgaa
gaattgctggacattttaggggttcctgcatccatgcttcctgaagtgaaaccttcctct
gaaatatacggagaaattgcgggtaatcatttctttggtcatcgtgtaccgatcgcaggt
attgcaggagatcaacaggcggcattattcggtcaagcttgctatgaacaaggaatggtg
aaaaatacttacggtacaggttgtttcatgctgatgaacacaggtgaggaagcggtaaag
tcagagcatggtcttcttacaactatcgcatggggttatgatggcaaagtgacatatgcg
cttgaaggaagtatctttgtagccggttcggccattcagtggcttcgtgacggactacgg
atgttccggaaatctgctgagagtgaggcatatgctgctcgtgtaaaagatacagatggt
gtgtatgttgtgccggcatttgtcggacttggaacaccgtattgggatagtgaagtgcga
ggagcagtattcggtttaacacgcggtacgtcgaaggaacagtttatccgtgcgacattg
gaatcgcttgcctatcaaactcgggacgtgttatcggctatggaatccgattcaggcatc
gacttaaggaaactgcgcgttgacggtggtgctgtgatgaacgactttttaatgcaattc
cagtcagatattttaaatgtgcctgttgaccgtccttcagtcaatgaaacgacggcactt
ggcgcagcgtatttagccggattggctgtcggattctgggagaacctcgatgaagtgcaa
caacattggcaactcaatcgtcaattcgagccgacaatggatgaagagcagcgtgaatca
ttatttacaggctggcacaaagccgttaaagcagcgcaagcgtttaagtga

DBGET integrated database retrieval system