KEGG   Solibacillus silvestris: SSIL_1773Help
Entry
SSIL_1773         CDS       T02162                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
siv  Solibacillus silvestris
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:siv00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:siv00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:siv02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861350..1863008
Genome map
AA seq 552 aa AA seqDB search
MMKNKKKWFTYALAGTVAVSSLSVMQFNTEAEAKQAKKEPTNVIMLVMDGSSNNAVSLAR
WYKGESLAMDEILTGGVTTYSAESAITDSAPAGTALATGHKSNSGYVGVLPSVIDMPGVE
GNPDNAFTPVANVLEGAKQLGKATGIVSTSEIQHATPASFSSHVTSRSNYDDIGEQQVYQ
NMDVILGGGYDYLKSENRKDGENLVSVIEDKGYDLITTRDELLTSNSNKIYGSFAGSSLA
YDLDRTKTNSNEPSLAEMTSKAIDTLNKDKDGFFLMIEGSKIDWAAHANDPIGMVTDILS
FDDAVNEALKFAKKDKNTMVIAVTDHGNSGITIGNENTSSTYDKINISNYINPLKKATMT
VEGALSQLKPDRSNLVEVAKLYGLDNLTAEETAALNATETKKLAGTFVNLLSKRADLGYT
TGGHTGDDVFLYSYGPKRISGLVDNTDLAKEMANFMGIKLDKLTKDLYANAEAALNGKGM
TTTIDLSDKENAVLVVKKGTTTFEIPENKNVIIKKTTDKSGKETTNEIQTNTISVYNESG
FYISKETINKLK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaagaacaagaaaaaatggtttacatatgcacttgcggggacagtggcagtatca
tctctttctgtcatgcagttcaatactgaagctgaagcgaaacaagcaaaaaaggagcca
actaatgtcatcatgctcgtgatggacggttccagcaataacgctgtatcgttagctcgc
tggtacaaaggtgaaagtctcgcaatggatgaaattttaacaggtggtgtgacaacgtat
tcagcagaatcagctattacagattcggcaccagctggaacggcacttgctaccggccat
aaatcaaacagcgggtatgtaggggtactgccatccgtaattgatatgccgggcgtagaa
ggaaacccggacaatgcatttacaccagttgcaaatgtgttagaaggagcaaaacaatta
ggcaaggctacaggaatcgtgtcaacttctgaaattcagcatgcgacacctgccagtttc
tcttcacacgtaacgtctcgcagtaattatgacgatatcggagaacaacaagtgtatcaa
aatatggatgtgattcttggcggcggatatgattacttaaaatcagaaaaccgaaaagat
ggcgaaaatctagttagcgtaattgaagataaaggatatgacctaattacaacgcgtgat
gagttactaacgtccaattccaataaaatttacggtagttttgccggcagttctttagcg
tatgatctagatcgtacgaaaacaaactcaaatgaaccttcactggcagaaatgacatca
aaagcaatcgatacgctgaacaaagataaagatgggttcttccttatgattgaagggagt
aaaatcgactgggcagctcatgcgaatgatccaatcggaatggttacggatattttgtca
ttcgatgatgcggtaaatgaagcgctgaaatttgcgaaaaaagacaagaatacgatggtt
atagcagtaacagatcacggcaacagcgggattacgattggtaatgaaaacacgagctct
acatatgacaaaattaatatatccaattatataaatccattgaagaaggcaacgatgaca
gtggaaggtgcactaagtcaattaaagccggaccgttcgaatttagtggaagtagctaaa
ttatatggactggataatttaactgcagaggaaacggctgccctgaacgcaacagaaacg
aagaagcttgccggtacattcgtcaatcttttatcaaaacgtgccgatttaggatacact
actggaggacatacaggcgatgacgtattcctgtactcatatggaccaaaacgcatttcc
ggactagtagataatactgatttagcaaaagaaatggccaacttcatgggcattaagtta
gataaattaacaaaagatctttacgctaacgcagaagcagcactgaatggcaaaggaatg
acgactacaatcgacctttcggataaggaaaatgcggtacttgtagtgaaaaaaggcacg
actacttttgaaatccctgaaaataagaatgttatcattaaaaaaacaacggataaatca
ggcaaagagactacaaatgaaattcagacaaatacaatcagcgtatacaatgaaagtggt
ttctatatttcaaaagaaacaatcaacaagcttaagtaa

DBGET integrated database retrieval system