KEGG   Solibacillus silvestris: SSIL_2086Help
Entry
SSIL_2086         CDS       T02162                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
siv  Solibacillus silvestris
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSIL_2086
   00670 One carbon pool by folate
    SSIL_2086
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SSIL_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2152672..2153142
Genome map
AA seq 156 aa AA seqDB search
MISLIVAHDENRVIGYQNDLPWYLPGDLKYFKEMTMGKPMIMGRKTYDSIGRPLPGRRNI
VITRNKDFAAEGIEIVGSLEEALVLVEGEAEVMIIGGAQIFEQSMAIADRLYITFINHSF
KGDTYFPSYDDWKQISCLDPIESDEGYTFQYCIYEK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgatttcattaatcgttgcacatgatgaaaaccgggttattggctatcaaaacgatttg
ccgtggtatttaccgggagatttgaaatactttaaagaaatgacaatgggaaaaccgatg
attatgggccgtaaaacatatgattcaattggccgaccgttaccgggacgtagaaatatt
gtcattacaagaaataaagactttgcagcagaaggtattgaaatagtaggtagtctggaa
gaagctttggtgcttgttgaaggtgaagcggaagtgatgatcattggtggtgctcaaatt
tttgaacagtccatggccattgccgatcggttatatattacattcatcaaccatagtttt
aaaggggacacttattttccgtcatacgatgactggaaacaaatctcatgtctcgaccca
atcgagtctgatgaaggatatacattccagtattgtatttatgaaaaataa

DBGET integrated database retrieval system