KEGG   Solibacillus silvestris: SSIL_2107Help
Entry
SSIL_2107         CDS       T02162                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
siv  Solibacillus silvestris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSIL_2107
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSIL_2107
  Amino acid metabolism
   00310 Lysine degradation
    SSIL_2107
Enzymes [BR:siv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SSIL_2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2177484..2178737
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESITEGTIAQWVKKVGDRVEKGEFIVELETDKVNAEIISEEAGVLKQILA
EEGDTVLVGQVIAVVEAGEGAAPAPAAKEEAPAAAPAKEEAPKAAAPAPVAVEETSGERV
IASPAARKLAREKGIDLAAISPVDPQGRVRVQDVAAHGTAPAAPAAAPAPAAGNGPMIFT
PAADTDRVTVEKMSRRRQTIAKRLLEVKQSTAMLTTFNEIDMTNIMALRKRKQDEFVKAN
DIKLGFMSFFTKAVVAALKKYPYVNAQINGDEIHLNNFFDIGIAVSTEEGLVVPVVRDAN
AKNFAEIEKNIAELAGKARDKKLGLNDMAGGSFTITNGGVFGSLMSTPIMNGTQAGILGM
HSIVNRPVAVNGEVQIRPMMYVALSYDHRIIDGKDSVGFLKTVKEMIENPEDLLLNS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaattaaagtccctgaattagcagaatcaattactgaaggaacaattgcccaa
tgggtgaaaaaagttggagatcgcgtagaaaaaggcgaattcatcgttgagttagaaact
gataaagttaatgctgaaattatctctgaagaagcaggcgttttaaaacaaattttagct
gaagaaggcgatactgtattagttggacaagtaatcgcagtagttgaagcaggcgaaggc
gcagcaccagcaccagctgcaaaagaagaagctccagcagcagctccagcaaaagaagaa
gctcctaaagcagcagcaccagcaccagttgcagttgaagaaacttcaggtgagcgtgta
atcgcttcaccagcagcacgtaaattagctcgtgaaaaaggtatcgacttagcagcaatt
tcaccagttgatccacaaggtcgtgtacgtgttcaagacgttgcagcacatggtacagct
cctgcggctccagcagcagctccagctccagcagcaggcaatggtccaatgatctttaca
ccagcagctgatacagaccgtgtaacagttgaaaaaatgagccgtcgtcgtcaaacaatt
gcaaaacgtttattagaagttaaacaatcaactgcaatgttaactactttcaatgaaatt
gatatgacgaacattatggcattacgtaagcgtaaacaagatgagttcgtgaaagctaac
gatattaaattaggcttcatgtcattcttcacaaaagctgtagtagcagcattaaagaaa
tatccatatgtaaatgcacaaattaacggtgatgaaattcacttaaacaacttcttcgat
atcggtattgctgtatcaacagaagaaggtttagtagtaccagtagttcgtgatgcaaat
gcgaaaaactttgctgaaatcgagaaaaacattgcggaattagctggtaaagcacgcgac
aaaaaattaggcttaaacgacatggctggcggatcattcacaatcactaacggtggtgta
ttcggttcattaatgtctacaccgatcatgaacggtactcaagctggtattttaggtatg
cactcaatcgtaaaccgtccagtagctgttaatggtgaagttcaaattcgtccaatgatg
tatgtagcattatcttatgaccaccgtatcatcgatggtaaagattctgttggcttctta
aaaacagttaaagaaatgatcgaaaatccagaagatttattattaaattcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system