KEGG   Solibacillus silvestris: SSIL_2107Help
Entry
SSIL_2107         CDS       T02162                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
siv  Solibacillus silvestris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSIL_2107
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSIL_2107
  Amino acid metabolism
   00310 Lysine degradation
    SSIL_2107
Enzymes [BR:siv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SSIL_2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2177484..2178737
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESITEGTIAQWVKKVGDRVEKGEFIVELETDKVNAEIISEEAGVLKQILA
EEGDTVLVGQVIAVVEAGEGAAPAPAAKEEAPAAAPAKEEAPKAAAPAPVAVEETSGERV
IASPAARKLAREKGIDLAAISPVDPQGRVRVQDVAAHGTAPAAPAAAPAPAAGNGPMIFT
PAADTDRVTVEKMSRRRQTIAKRLLEVKQSTAMLTTFNEIDMTNIMALRKRKQDEFVKAN
DIKLGFMSFFTKAVVAALKKYPYVNAQINGDEIHLNNFFDIGIAVSTEEGLVVPVVRDAN
AKNFAEIEKNIAELAGKARDKKLGLNDMAGGSFTITNGGVFGSLMSTPIMNGTQAGILGM
HSIVNRPVAVNGEVQIRPMMYVALSYDHRIIDGKDSVGFLKTVKEMIENPEDLLLNS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaattaaagtccctgaattagcagaatcaattactgaaggaacaattgcccaa
tgggtgaaaaaagttggagatcgcgtagaaaaaggcgaattcatcgttgagttagaaact
gataaagttaatgctgaaattatctctgaagaagcaggcgttttaaaacaaattttagct
gaagaaggcgatactgtattagttggacaagtaatcgcagtagttgaagcaggcgaaggc
gcagcaccagcaccagctgcaaaagaagaagctccagcagcagctccagcaaaagaagaa
gctcctaaagcagcagcaccagcaccagttgcagttgaagaaacttcaggtgagcgtgta
atcgcttcaccagcagcacgtaaattagctcgtgaaaaaggtatcgacttagcagcaatt
tcaccagttgatccacaaggtcgtgtacgtgttcaagacgttgcagcacatggtacagct
cctgcggctccagcagcagctccagctccagcagcaggcaatggtccaatgatctttaca
ccagcagctgatacagaccgtgtaacagttgaaaaaatgagccgtcgtcgtcaaacaatt
gcaaaacgtttattagaagttaaacaatcaactgcaatgttaactactttcaatgaaatt
gatatgacgaacattatggcattacgtaagcgtaaacaagatgagttcgtgaaagctaac
gatattaaattaggcttcatgtcattcttcacaaaagctgtagtagcagcattaaagaaa
tatccatatgtaaatgcacaaattaacggtgatgaaattcacttaaacaacttcttcgat
atcggtattgctgtatcaacagaagaaggtttagtagtaccagtagttcgtgatgcaaat
gcgaaaaactttgctgaaatcgagaaaaacattgcggaattagctggtaaagcacgcgac
aaaaaattaggcttaaacgacatggctggcggatcattcacaatcactaacggtggtgta
ttcggttcattaatgtctacaccgatcatgaacggtactcaagctggtattttaggtatg
cactcaatcgtaaaccgtccagtagctgttaatggtgaagttcaaattcgtccaatgatg
tatgtagcattatcttatgaccaccgtatcatcgatggtaaagattctgttggcttctta
aaaacagttaaagaaatgatcgaaaatccagaagatttattattaaattcttaa

DBGET integrated database retrieval system