KEGG   Solibacillus silvestris: SSIL_2190Help
Entry
SSIL_2190         CDS       T02162                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
siv  Solibacillus silvestris
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SSIL_2190
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SSIL_2190
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSIL_2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261112..2261675)
Genome map
AA seq 187 aa AA seqDB search
MSIYNYLVKKTNGEILSMETYRDQVMLIVNTASNCGFTFQYEDMQKLYERYAAKGFTVLS
FPCNQFGEQNPEDGETSARQCKLQFGVTYPVFDKIDVNGKETHPLFNYLKHEVDCPEFVR
DTMQQKHLYNTIQTNYPDYLIGRNIRWNFTKFLVDRNGRVIQRFEPDASFLDIENAIEQL
LETAAVK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttataattatttagtgaaaaaaacgaacggtgagatcctgtcaatggaaact
tatcgtgatcaagtgatgttgattgtgaacacggcaagtaactgcggatttacttttcaa
tatgaagacatgcaaaagttatatgaacgctatgcagcaaaagggttcacagtactatca
tttccatgcaaccaatttggcgagcagaacccggaagacggagaaacgtccgcaagacaa
tgcaagctacagttcggtgttacatatccagtatttgataaaatcgatgtgaatggcaaa
gagactcatccgctattcaactacttaaaacacgaggttgattgtccggaatttgtacgt
gatacaatgcagcaaaaacatttgtacaatacaatccaaacaaactatcctgattattta
atcggccgcaatattcgctggaatttcacgaagttcctagtagaccgaaacggccgtgtc
atccaacgttttgagccggatgcttcattcctggatatcgaaaatgcgattgaacagctt
ttggaaactgcagctgtaaaataa

DBGET integrated database retrieval system