KEGG   Solibacillus silvestris: SSIL_2190Help
Entry
SSIL_2190         CDS       T02162                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
siv  Solibacillus silvestris
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:siv00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:siv00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261112..2261675)
Genome map
AA seq 187 aa AA seqDB search
MSIYNYLVKKTNGEILSMETYRDQVMLIVNTASNCGFTFQYEDMQKLYERYAAKGFTVLS
FPCNQFGEQNPEDGETSARQCKLQFGVTYPVFDKIDVNGKETHPLFNYLKHEVDCPEFVR
DTMQQKHLYNTIQTNYPDYLIGRNIRWNFTKFLVDRNGRVIQRFEPDASFLDIENAIEQL
LETAAVK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttataattatttagtgaaaaaaacgaacggtgagatcctgtcaatggaaact
tatcgtgatcaagtgatgttgattgtgaacacggcaagtaactgcggatttacttttcaa
tatgaagacatgcaaaagttatatgaacgctatgcagcaaaagggttcacagtactatca
tttccatgcaaccaatttggcgagcagaacccggaagacggagaaacgtccgcaagacaa
tgcaagctacagttcggtgttacatatccagtatttgataaaatcgatgtgaatggcaaa
gagactcatccgctattcaactacttaaaacacgaggttgattgtccggaatttgtacgt
gatacaatgcagcaaaaacatttgtacaatacaatccaaacaaactatcctgattattta
atcggccgcaatattcgctggaatttcacgaagttcctagtagaccgaaacggccgtgtc
atccaacgttttgagccggatgcttcattcctggatatcgaaaatgcgattgaacagctt
ttggaaactgcagctgtaaaataa

DBGET integrated database retrieval system