KEGG   Solibacillus silvestris: SSIL_2457Help
Entry
SSIL_2457         CDS       T02162                                 

Definition
fructose-2,6-bisphosphatase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
siv  Solibacillus silvestris
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSIL_2457
   01230 Biosynthesis of amino acids
    SSIL_2457
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_2457
  Energy metabolism
   00680 Methane metabolism
    SSIL_2457
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSIL_2457
Enzymes [BR:siv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSIL_2457
Exosome [BR:siv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSIL_2457
  Exosomal proteins of melanoma cells
   SSIL_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2504522..2505058)
Genome map
AA seq 178 aa AA seqDB search
MKLYIIRHCEANGQAPNACLTLAGSEVSGRLAKFLSGLNIELVISSPFTRAVHTIQPFIL
QNNIPLKLDDRLKERVLSSEDLPDWYEKLQQTYIDKKLNFTGGESSNEATKRINELVEEL
KQRNYKSVAIVTHGNIMSLLLNYYQPHFGFEEWKQLSNPDVFEMDFSKEHPVGNRIWR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattatatataattcgccattgtgaagccaatgggcaagcaccaaatgcatgctta
acgttggctgggagtgaagtaagcgggcgtttagcaaagtttttatctggcttaaatata
gagctagtcatttcaagtccatttacgagggcagttcatacaatacaacctttcattcta
caaaacaacattccacttaaattagatgaccgtctaaaggaaagggttttaagcagtgaa
gatcttcccgattggtatgaaaagttacagcaaacctatattgataagaagttaaatttt
actggcggggaatcaagtaatgaagcgacaaaacgtattaatgaattggtggaagaatta
aaacaaagaaattacaagtcagtggcaatcgttacacatggcaatatcatgtcattacta
ctcaattattatcaaccgcattttggattcgaggaatggaagcaactgtcgaatccggat
gtctttgaaatggattttagcaaagaacatccagttggaaatcgtatatggcggtaa

DBGET integrated database retrieval system