KEGG   Solibacillus silvestris StLB046: SSIL_2457Help
Entry
SSIL_2457         CDS       T02162                                 

Definition
(GenBank) fructose-2,6-bisphosphatase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00010  Glycolysis / Gluconeogenesis
siv00260  Glycine, serine and threonine metabolism
siv00680  Methane metabolism
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01120  Microbial metabolism in diverse environments
siv01130  Biosynthesis of antibiotics
siv01200  Carbon metabolism
siv01230  Biosynthesis of amino acids
Module
siv_M00002  Glycolysis, core module involving three-carbon compounds
siv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_2457
  Energy metabolism
   00680 Methane metabolism
    SSIL_2457
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSIL_2457
Enzymes [BR:siv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSIL_2457
Membrane trafficking [BR:siv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SSIL_2457
Exosome [BR:siv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSIL_2457
  Exosomal proteins of melanoma cells
   SSIL_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Fer4_12 Fer4_14 SnAC PHP Hydant_A_N Ribosomal_S17_N
Motif
Other DBs
NCBI-ProteinID: BAK16880
UniProt: F2F1L7
Position
complement(2504522..2505058)
Genome map
AA seq 178 aa AA seqDB search
MKLYIIRHCEANGQAPNACLTLAGSEVSGRLAKFLSGLNIELVISSPFTRAVHTIQPFIL
QNNIPLKLDDRLKERVLSSEDLPDWYEKLQQTYIDKKLNFTGGESSNEATKRINELVEEL
KQRNYKSVAIVTHGNIMSLLLNYYQPHFGFEEWKQLSNPDVFEMDFSKEHPVGNRIWR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattatatataattcgccattgtgaagccaatgggcaagcaccaaatgcatgctta
acgttggctgggagtgaagtaagcgggcgtttagcaaagtttttatctggcttaaatata
gagctagtcatttcaagtccatttacgagggcagttcatacaatacaacctttcattcta
caaaacaacattccacttaaattagatgaccgtctaaaggaaagggttttaagcagtgaa
gatcttcccgattggtatgaaaagttacagcaaacctatattgataagaagttaaatttt
actggcggggaatcaagtaatgaagcgacaaaacgtattaatgaattggtggaagaatta
aaacaaagaaattacaagtcagtggcaatcgttacacatggcaatatcatgtcattacta
ctcaattattatcaaccgcattttggattcgaggaatggaagcaactgtcgaatccggat
gtctttgaaatggattttagcaaagaacatccagttggaaatcgtatatggcggtaa

DBGET integrated database retrieval system