KEGG   Solibacillus silvestris StLB046: SSIL_2960Help
Entry
SSIL_2960         CDS       T02162                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00900  Terpenoid backbone biosynthesis
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSIL_2960
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SSIL_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAK17383
UniProt: F2F2T5
Position
complement(3024651..3025796)
Genome map
AA seq 381 aa AA seqDB search
MKKISLLGATGSIGWQTFDILLANPNEFKLVAFSAGQNIEKSREIIKKLQPELVSMQTEE
AAGTLQKEFPHISFTYGEKGLVEVATHPDSTVLINAVLGSVGLESTLAAIRMGKTIAIAN
KETLVTAGHLVMAEAKKYNAPILPVDSEHSAVFQSMNGENKKRIERIVLTASGGSFRDRT
RDELVGVTVKDALNHPNWSMGAKITIDSATMMNKGLEVIEAHVLFDMPYDNIDVLLHRES
IIHSMVEYEDTSVIAQLGTPDMRVPIQYALSYPDRLPLANGQRLNLAQIGQLHFKEVDFD
RFRALKLAYDAGRMGGTILTAMNAANEAAVALFLQEKITFLEIEECIERIMNSHNNIALP
DLATILHVDSETRKTVASMVK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattagtttattaggtgcaacaggttccatcggatggcaaacctttgatatt
ttacttgcaaatccgaatgaatttaagcttgttgcattttcagccggacaaaatattgaa
aagtcccgcgaaatcataaaaaaactgcaaccagaattagtttcaatgcaaacagaggaa
gcggcaggcactttacaaaaagagtttccgcatatttcctttacatatggtgaaaaagga
ttggtcgaagtagcgacacatcctgattcgacagtgcttattaatgcggtattaggcagc
gttggactggaatcgacacttgctgcgatccgcatggggaaaacaattgccattgcaaac
aaagaaacacttgtaacagcaggtcatcttgtcatggctgaagcaaaaaaatacaatgca
ccgatcttaccggtagatagtgaacattctgctgttttccaatcgatgaacggtgaaaac
aaaaagcgtatcgagcgcattgttttaacggcatcaggtggttcattcagagatcgaaca
agagatgagctagtaggagtaacggtaaaagatgctctgaatcatccgaactggtcaatg
ggagccaaaattacgattgactcagcaacaatgatgaataaagggcttgaagtgattgag
gcacatgtattgtttgatatgccttatgacaacatcgacgtattgctgcaccgagagagc
atcattcactcgatggttgaatatgaggatacaagtgtcatcgcacagcttggaacaccg
gacatgcgtgtaccgattcaatatgcgcttagctatccggatcgtctgccgcttgcaaat
ggccaacgtttaaatttggcccaaattggacagcttcattttaaggaagtggattttgac
cgtttccgtgcattaaagcttgcttatgatgcagggcgcatgggcgggacaatcttaacg
gcaatgaatgcagcaaacgaagcagccgttgcattgtttttacaagaaaaaattactttt
ttagaaattgaagaatgtattgagcgtattatgaatagtcataacaatatcgctttgcca
gatttagcaactattttacatgtagacagtgaaacgagaaaaacagtcgcaagcatggta
aaatag

DBGET integrated database retrieval system