KEGG   Solibacillus silvestris: SSIL_3075Help
Entry
SSIL_3075         CDS       T02162                                 

Definition
aspartate carbamoyltransferase, catalytic chain
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
siv  Solibacillus silvestris
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSIL_3075
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSIL_3075
Enzymes [BR:siv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SSIL_3075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3140043..3140960)
Genome map
AA seq 305 aa AA seqDB search
MKNLLSMEHLSNEEIMMILNRAQHFENGGNPVLQREFHVANLFFEPSTRTKTSFEMAERR
LGCTVIPFDAEFSSTTKGETLYDTVKTLEMIGIDAVVIRDKEDEYYNELLEGIGCAVINA
GDGAGQHPSQSLLDLYTIQKEFGRFEDLNITIVGDISHSRVAKSNATALTRLGANVRFLC
PPAWAGNFEAAHSWDEVLEDSDVIMLLRIQHERHSVSKNFSKESYHAEYGLTIEREQRMK
ERAIIMHPAPVNRDVEIADALVECSRSRIFEQVRNGVFTRMAILETILKGRDQYDNSYTK
CEATQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttattatcgatggaacatttgtcaaatgaagaaataatgatgattttaaat
cgagcacagcatttcgaaaatgggggaaaccctgtgttacaacgcgaatttcatgtagca
aaccttttctttgagccaagtacacgtacaaaaacgagctttgaaatggcggagcgtcga
ctaggatgtacagttataccgtttgatgccgagttttccagcacaacaaagggagaaacg
ctgtacgatacagtcaaaacattggaaatgatcggaatcgatgctgtcgttattcgagat
aaggaagatgaatattacaacgagcttctagaaggcatcgggtgtgcggtcattaatgca
ggtgatggcgctggccaacatccttcccagtcattgctggatttatatacgattcaaaaa
gagttcggtcgatttgaagacttgaatattacgatcgtcggtgatatttcacatagccgt
gtcgcaaaatcaaatgccacagcacttactcgattaggggcaaatgttcgattcctttgt
ccgccggcatgggcaggcaattttgaagcggcacatagctgggatgaagtgctggaagac
agcgatgtcattatgctgctgcgaatccagcatgaacgtcactccgtaagtaaaaacttt
tcaaaagaaagctaccatgcagagtatggtttaacgattgaacgtgaacagcggatgaaa
gagagggccatcattatgcacccggcaccggtaaaccgcgatgtggaaattgcggatgcc
cttgtagaatgcagtcgttcccgcatttttgaacaagtgcggaacggtgtatttacacga
atggccattttagaaacgattttgaaaggaagagatcaatatgacaacagttatacaaaa
tgtgaagctactcaatga

DBGET integrated database retrieval system