KEGG   Solibacillus silvestris: SSIL_3124Help
Entry
SSIL_3124         CDS       T02162                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
siv  Solibacillus silvestris
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:siv00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:siv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3188910..3190391)
Genome map
AA seq 493 aa AA seqDB search
MQIGELIKDWPCTMKGSIRVEIKRVEDDANLILPGDAFIARKGNNSSGISYIDSALEKGA
AAIVVDDENYFNEADLPVPIIWVPNCLSFIAYASAKIYNFPAEALTVIAVTGTNGKTTVT
HFIGQILNQLDKRAMVIGTNGVFIDREKCYPEMEALTTLQAKNIQFLFKEAIRLDVPYVV
LEASSIGLEKHRLDHCDIDIGIFLNVTEDHIEDHGSFERYKLSKQILSTLAKKNIINSDD
SVCRSIGLATKGKRIFFGKGSHVDYFFQTLVDGPASTTCCIQHKKEKHIVNIPLVGDYQC
SNVLAAISCIAQLDFPLSDICNTIGNLVLPEGRFEHVENQLGLSIVVDYAHTPDAMKMIL
QTLKKHTKRRLIVMFSCGGNRDKAKRPKMGMIASIYADYIILTTDNARNENPQQINKQIR
EGFSSTQEYIECLNRKEAIEHALNYAEKGDTIVLLGKGHEKTQQIGDKQKYFSDLVFVRE
MIRQLEKRRLNNH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaattggagaattaattaaagactggccgtgcactatgaagggctccattagagtg
gaaataaaacgagtggaagacgatgcgaatcttattttacctggagatgcttttatcgcc
aggaagggaaataattcgagtggtatttcgtatattgatagcgctttggaaaagggcgca
gcagcaattgtagtagatgatgaaaattactttaatgaagcggatttacctgtaccgatt
atttgggtaccgaactgtttaagttttattgcttatgcaagtgcaaaaatttataatttc
cctgccgaagcattaaccgtaatcgcagtaacgggaacaaacggcaaaacaactgttaca
cattttataggacaaattttaaaccagttggataagcgcgctatggtgatcgggacaaat
ggtgtttttatcgaccgggaaaaatgttatccggaaatggaagcactaacaacattacag
gcgaaaaatattcaatttttatttaaagaagcaatccgtcttgatgtaccttacgttgtt
ctggaagcttcgtccattggtctggaaaagcaccgtctggatcattgtgatattgatatc
ggtattttcttgaatgtgacagaagatcatattgaagaccatggtagttttgaacgctac
aaactatccaaacagattttatcgactttggcgaaaaaaaatattataaatagtgatgac
agtgtttgtcgttcaatcggtttagcgacaaaaggcaagcgtatttttttcggcaaaggg
agccatgtcgactactttttccaaacgctagttgacggaccagcatcaacgacttgctgt
attcagcataagaaagagaagcatatagtgaacatcccgttagtgggagactatcaatgc
agcaatgtgcttgcagcgatcagctgtattgcacaacttgattttccgttaagtgacatc
tgcaatacaatcggaaatttagtattgcctgaaggtcgttttgagcatgtggaaaatcag
ttaggcttatcgatcgtcgtcgattatgcacatacaccggatgcgatgaaaatgatttta
cagacattgaaaaaacatacaaagcgccgattaattgtcatgtttagttgcggcggtaac
cgagacaaggcaaaacgtccaaaaatgggaatgattgcatcaatttatgcggattatatt
attttaacgaccgataatgctcgtaacgaaaatccgcagcagatcaataaacagatccgc
gaaggcttttcttctacacaggagtatattgagtgcctcaaccgaaaagaagccattgag
catgcacttaattatgcggaaaaaggcgatacaatcgtactgttaggtaaaggtcatgaa
aaaacacagcagattggagacaaacaaaaatacttttccgatttagtatttgttcgggaa
atgataagacaattggaaaaacgtaggttgaacaatcattga

DBGET integrated database retrieval system