KEGG   Solibacillus silvestris StLB046: SSIL_3152Help
Entry
SSIL_3152         CDS       T02162                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00010  Glycolysis / Gluconeogenesis
siv00020  Citrate cycle (TCA cycle)
siv00620  Pyruvate metabolism
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01120  Microbial metabolism in diverse environments
siv01130  Biosynthesis of antibiotics
siv01200  Carbon metabolism
Module
siv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_3152
   00020 Citrate cycle (TCA cycle)
    SSIL_3152
   00620 Pyruvate metabolism
    SSIL_3152
Enzymes [BR:siv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSIL_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N Macoilin
Motif
Other DBs
NCBI-ProteinID: BAK17575
UniProt: F2F756
Position
complement(3217703..3219082)
Genome map
AA seq 459 aa AA seqDB search
MAFTFRLPDIGEGIHEGEIVKWFVKPGDQVKEDDILAEVQNDKAVVEIPSPVDGTVEEIF
VEEGTVAIVGDALIRFDAPGYEDLKLKGDDHHESNESNKTEAQVQSTAEAGQDVKKEETK
SDKNADTAHPGAPAETEKAASPSESETSGKRIIAMPSVRKYAREKGVEIQQVSGTGKNGR
VLKEDIESFLNGGQQSASETEEVKETQEEEKQAATKQAAPVALEGEFPETREKMSGIRKA
IAKAMVHSKHTAPHVTLMDEVDVTELVAHRKQFKDIAAEQGVKLTFLPYVVKALISTLRK
YPEFNRSLDDATQEIIQKHYYNIGIAADTERGLLVPVLKHADRKSVFGLSQEINELAVKA
RDGKLAPHEMKGASMSISNIGSAGGQWFTPVINHPEVAILGIGRISEKPVIKNGEIVAAH
VLALSLSFDHRMIDGATAQNALNHLKRLLSEPQLLLMEA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacgtttcgtttaccagatatcggagaaggtattcatgaaggtgaaatcgtc
aaatggttcgttaaacctggcgatcaagtaaaagaagacgatattttagcagaagttcaa
aatgataaagcagtcgtagaaattccgtcaccagttgatggtacagtagaagaaattttc
gtagaagaaggaacggtggcgattgtcggggatgccttaatccgctttgatgcaccaggc
tatgaagatttaaaactaaaaggtgatgaccaccacgaatcaaatgaatcaaataaaaca
gaagcacaagtacagtctactgctgaggctggccaggatgtgaaaaaagaagaaactaaa
tcggataaaaatgcagacactgctcatccgggagctccagctgaaacggaaaaagctgca
tcaccatctgaatcagaaacttcaggcaaacgcattatcgcaatgccttctgtccgtaag
tatgctcgtgaaaaaggtgtcgagattcagcaagtttctggcacaggcaaaaatggccgt
gtgcttaaagaagatattgaaagcttcctaaatggaggtcaacagtctgcttctgaaaca
gaagaagtgaaagagacacaagaagaagaaaaacaagcagcaacaaaacaagctgctcca
gttgcgcttgaaggggaattccctgaaacacgcgaaaaaatgagcggtatccgcaaggca
attgcaaaagcgatggttcattcaaaacatacggctccgcacgtaacgttaatggatgaa
gtggacgtaacagaacttgttgcacaccgtaagcaattcaaagatattgcagcagagcaa
ggtgttaaattaacgtttttaccgtacgttgtgaaagctttaatctcgactttgcgtaaa
tatcctgaatttaaccgttcactggatgatgcaacacaagaaattattcaaaaacattac
tataatattggtattgcagctgacacagaaagaggtttattagttcctgttcttaagcat
gctgatcgtaaatctgtattcggcttatcacaggaaattaatgaattggctgtaaaagca
cgtgatggtaagctagcaccgcatgaaatgaagggtgcgtcaatgtcgatttcaaatatc
ggttcagctggtggacaatggttcacaccggtaattaaccatcctgaagtagcgatctta
ggaattggtcgtatttcagagaaaccagtaataaaaaatggtgaaattgtagcagcacat
gtgttagcattatcattgagctttgatcatcgaatgatcgatggagcgactgcacaaaac
gctttaaatcatttaaaacgtttattaagtgagccgcaactattattaatggaggcgtaa

DBGET integrated database retrieval system