KEGG   Solibacillus silvestris: SSIL_3395Help
Entry
SSIL_3395         CDS       T02162                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
siv  Solibacillus silvestris
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:siv00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:siv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3512926..3514203)
Genome map
AA seq 425 aa AA seqDB search
MDVYKIQGGNRLKGKITVSGAKNSAVALIPASILADSSVTIGGIPEISDAWTLKALLEEI
GGEVTFENGKMTIDPSKMVAMPLPNGNVKKLRASYYMMGAMLGRFKQAVIGMPGGCFLGP
RPIDQHIKGFEALGAKVTNEHGAIYLRADELIGAKIYLDVASVGATINIMLAAVRAKGKT
TIENAAKEPEIIDVATLLTNMGANIKGAGTSVIRIEGVDELKGTKHTIIPDRIEAATFMI
MAAAIGDGVLVDNVIPLHMEAVTAKLREMGVTVEENEESIYISKQKNLQAVDVKTLVYPG
FPTDVQQPLSVLMTQAEGTSMITDTIYSARFKHIDELRRMSAKARVEGNTAIIQGPASLE
GSTVTATDLRAGAALVLAGLIAKGETEIHDIYHIERGYSSLIEKLCAIGANIRKESIVIK
TKNNA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttataaaattcagggcggaaatcgtctaaaaggtaaaataaccgttagcggt
gcaaaaaatagcgcagttgctttaattcctgcatcaattttggcagattcttccgttacc
attgggggaattccagaaatttcagatgcatggacgttaaaagcacttctagaagaaatt
ggcggagaagtaacattcgaaaatggcaagatgacgattgatccatcaaaaatggttgcg
atgccgctaccaaacggcaatgtaaaaaaattgcgtgcttcctattatatgatgggtgcc
atgctgggacgttttaaacaagcggtaatcggcatgccaggcgggtgttttttagggcca
cgtccaatcgatcaacatattaaaggttttgaagctttaggagcaaaagtaacaaatgag
cacggtgcgatttacttacgcgcagatgaattaattggtgcgaaaatttatctggatgtt
gcaagtgtcggcgcaacaattaatattatgctggcagcagtgcgggcaaaagggaaaact
acaatcgagaatgcagcgaaagagcctgagattattgatgttgcgacacttttaacaaat
atgggtgccaatattaaaggcgcaggaacgagcgttatccgtattgaaggtgtcgatgag
ctaaaaggtacgaaacatacaattataccggatcgaattgaagcagctacatttatgatt
atggctgcagcgattggtgatggtgtacttgtcgataatgtcattccgcttcacatggaa
gccgtaacagctaaacttcgcgaaatgggtgtaactgtggaagagaatgaggaaagcatc
tacatctcaaagcaaaagaacctgcaggcggttgatgtaaaaacactggtctatccagga
ttcccgactgatgttcaacagccgttatctgttttaatgacgcaggcggaagggacatcg
atgattacagatacaatttattctgcccgattcaagcatatagacgaactgcgacgtatg
agtgcaaaagcccgtgttgaaggcaatacggccatcattcaaggacctgcatctttggaa
ggatccacggtaacggcaacagatttacgcgcgggtgctgcattagtattggctggactt
atcgcaaaaggtgaaacagaaattcacgatatctaccatattgaacgcggctatagttca
ttaattgaaaagctttgtgcaattggtgcaaatattcgtaaagagtccattgtcattaaa
acaaagaataatgcataa

DBGET integrated database retrieval system