KEGG   Solibacillus silvestris: SSIL_3421Help
Entry
SSIL_3421         CDS       T02162                                 

Definition
arginase/agmatinase/formimionoglutamate hydrolase, arginase family
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
siv  Solibacillus silvestris
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SSIL_3421
Enzymes [BR:siv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SSIL_3421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3545483..3546355)
Genome map
AA seq 290 aa AA seqDB search
MRFDETYAGNMFIKSHQNYEESKAVLYGMPMDWTVSYRPGQRFGPARIREVSVGLEEYSF
YLDRELADVPFFDAGDIPLPFGNPEKSLAEIKTFVRKVLADDKIPVGMGGEHLVSLPVME
AVYEKYEDLAIIHFDAHTDLRTDYEGEQYSHATPIRKIADTIGPDNVYSFGIRSGLKEEL
QWAKENGMHISLFEVFEPLKQVLPTLKGRNVYVTIDIDVLDPAHAPGTGTVDAGGITPKE
LLAAIHEIARSEVNVVGFDLVEVAPIYDHSEITVNTAAKLIREMILGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgatgaaacttacgcagggaatatgtttattaaaagccaccaaaactatgaa
gaaagtaaagccgttttatacggcatgccaatggactggacagttagctaccgtcccggt
caacgttttggtcctgcccgaattcgtgaagtatcggttggtttagaagaatacagtttt
tacttggatcgtgagctggcagatgtaccgttttttgatgcgggggatattccactgccg
tttgggaatccggaaaaatcattagcggaaattaaaacgtttgtccgtaaagtactggca
gacgataaaattccagtagggatgggcggggagcatttagtatcactgccggtaatggaa
gctgtctatgaaaagtacgaagatttagcgattattcattttgatgcacatacagattta
cgtacggattacgaaggggagcaatactcacacgcaacaccaattcgtaaaattgccgat
acaatcggaccggacaatgtttattcatttggaatccgttcaggcttaaaagaagagttg
cagtgggcaaaagaaaacggcatgcacatttcattatttgaagttttcgagccattaaaa
caagtattgcctacattaaaaggtcgcaatgtttatgtgacaatcgacattgacgtattg
gaccctgcacatgcacctgggacaggcacggttgatgctggcggtattactccaaaggaa
cttttagcagcaattcatgaaattgcacgatctgaagtaaatgttgtcggctttgaccta
gttgaggtggcaccaatttacgatcattccgaaataacagtaaatacagctgcaaaattg
attcgtgaaatgattttaggctgggtaaaatag

DBGET integrated database retrieval system