KEGG   Solibacillus silvestris: SSIL_3451Help
Entry
SSIL_3451         CDS       T02162                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
siv  Solibacillus silvestris
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSIL_3451
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSIL_3451
Enzymes [BR:siv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SSIL_3451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3573086..3573880
Genome map
AA seq 264 aa AA seqDB search
MTILDRIIDQKKTELPQLLSTKPMFLSIDKARPSLYETLMSANSLQVISEMKRASPSKGD
IATEVDPVEQALQYEEAGAACISVLTERAFFKGSYADLNAVANAVNIPVLCKDFIIHEVQ
IDYAKAAGASVVLLIVAALTDVQLKSLHAYATEKQLEVLVEVHDAEELKRALAIGANIIG
VNNRNLKTFDVSLSATLEIAQLLPPSPIAFISESGISGPEDAQFVANAGAKGILVGEALM
RSGNVKKSLKALQIDITAKVGENR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttagaccgtattattgaccaaaaaaagactgagctgccacaattgctttcg
acaaagcctatgtttttatcaattgataaggcccgaccttctttatatgaaacattgatg
tcagccaattcattgcaagtcatttcggaaatgaagcgtgcctccccttccaaaggtgat
attgcgacagaagtcgaccctgttgagcaagctttacaatatgaagaagcaggtgctgcc
tgtatttccgtattgacagagcgcgcattttttaaaggtagctatgcggatttaaatgca
gttgcaaatgccgtaaacatccctgttttatgtaaagacttcatcatccatgaagtgcag
atcgactatgcaaaggcagccggcgcatcggttgtactgttgattgtcgcagcattaaca
gacgttcagctgaaatccctacacgcctatgcgacagaaaaacagcttgaagtgctcgtt
gaagtacatgatgccgaggaattaaagcgtgcccttgccattggggcaaacatcatcggg
gtaaataaccggaatttgaaaacattcgatgtttcactttcagcaacacttgaaattgcg
cagcttcttcccccatcaccgattgcctttattagtgaaagcggcatttcaggtccggaa
gatgcacagtttgtggcgaatgctggcgcaaaaggaatattagtcggtgaggcattaatg
cggagcggaaacgtcaaaaaatcacttaaagccctacaaatcgacataacagcaaaggtt
ggcgaaaatcgatga

DBGET integrated database retrieval system