KEGG   Solibacillus silvestris StLB046: SSIL_3453Help
Entry
SSIL_3453         CDS       T02162                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00260  Glycine, serine and threonine metabolism
siv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01130  Biosynthesis of antibiotics
siv01230  Biosynthesis of amino acids
Module
siv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSIL_3453
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSIL_3453
Enzymes [BR:siv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSIL_3453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAK17876
UniProt: F2F7B7
Position
3574491..3575678
Genome map
AA seq 395 aa AA seqDB search
MTTVKGRFGRFGGQFVPETLMTSLEELELAYEEAKKDPSFQEELDYYLKQYVGRETPLYF
AERLTKKVGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKIVAETGAGQHGVATA
TACALLDMECIVYMGAEDVRRQQLNVFRMELLGTKVVAVEKGSATLKDAVNEALRHWVTH
IEDTHYILGSALGPHPFPTIVRDFQRVIGDETRAQILQQEGRLPDTVIACIGGGSNAIGM
FFPFVEDQDVALYGVEAAGSGVNTDKHAAAIHVGKTGVLHGAFMYLLQDDNGFVQEAHSI
SAGLDYPGVGPEHCHLHETGRAAYPSVTDEQALEGVKLLCETEGILPALESAHAIYYASQ
FAKNRPADEIVVVCLSGRGDKDVHTLMDKLGGGLK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagtaaaaggacgcttcgggcgattcggcggtcaatttgtgcccgagacattg
atgacttcacttgaggaattggagcttgcatatgaggaagcaaaaaaggacccctctttc
caggaagaacttgactattatttaaagcaatatgtcggacgggaaactccactttatttt
gcggagcgtttaacaaaaaaagtcggcggtgcgaaaatctatttaaagcgtgaagattta
aatcatactggcgcacataaaataaataatgcgatcggccaagcacttttagcaaagcgt
atggggaagaaaaagattgtcgctgaaacaggggcaggtcagcatggtgtcgcaacggca
actgcgtgtgcattgcttgatatggaatgtatcgtttatatgggggcagaagatgtacgc
cggcagcaactgaacgttttccgtatggagctcctcgggacaaaagttgttgcagtagaa
aaaggttccgcaacattaaaagatgcggttaatgaagcattgcgtcactgggttactcat
atagaagatacgcattacattttaggatcagcacttgggccacaccccttccctacaatt
gtccgtgatttccagcgtgtcattggggatgaaacacgtgcccaaattttacaacaggaa
ggacgtcttccggatacagttattgcttgtattggcggcggcagtaatgcaatcggaatg
ttcttcccattcgtggaagatcaggatgttgcattatatggcgtggaagctgcaggttcc
ggtgttaataccgacaagcatgcggcagcaattcatgttggaaaaacaggcgtccttcac
ggtgcgttcatgtacttattgcaggatgataacggttttgttcaagaagcccattcaatt
tcagcaggacttgattatccgggagttggacctgagcactgtcatttacatgaaacaggt
cgtgctgcctacccttctgttaccgatgaacaggcacttgaaggtgtgaagctgttatgt
gaaacagaaggaatcttgcctgcattggaaagcgcgcatgccatttactatgcaagtcaa
tttgccaagaaccgtcctgctgatgaaattgttgttgtttgcttatcaggtcgtggagac
aaagatgttcatacattaatggataaacttggaggtggcttgaaatga

DBGET integrated database retrieval system