KEGG   Solibacillus silvestris StLB046: SSIL_3453Help
Entry
SSIL_3453         CDS       T02162                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
siv  Solibacillus silvestris StLB046
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSIL_3453
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSIL_3453
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSIL_3453
Enzymes [BR:siv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSIL_3453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3574491..3575678
Genome map
AA seq 395 aa AA seqDB search
MTTVKGRFGRFGGQFVPETLMTSLEELELAYEEAKKDPSFQEELDYYLKQYVGRETPLYF
AERLTKKVGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKIVAETGAGQHGVATA
TACALLDMECIVYMGAEDVRRQQLNVFRMELLGTKVVAVEKGSATLKDAVNEALRHWVTH
IEDTHYILGSALGPHPFPTIVRDFQRVIGDETRAQILQQEGRLPDTVIACIGGGSNAIGM
FFPFVEDQDVALYGVEAAGSGVNTDKHAAAIHVGKTGVLHGAFMYLLQDDNGFVQEAHSI
SAGLDYPGVGPEHCHLHETGRAAYPSVTDEQALEGVKLLCETEGILPALESAHAIYYASQ
FAKNRPADEIVVVCLSGRGDKDVHTLMDKLGGGLK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagtaaaaggacgcttcgggcgattcggcggtcaatttgtgcccgagacattg
atgacttcacttgaggaattggagcttgcatatgaggaagcaaaaaaggacccctctttc
caggaagaacttgactattatttaaagcaatatgtcggacgggaaactccactttatttt
gcggagcgtttaacaaaaaaagtcggcggtgcgaaaatctatttaaagcgtgaagattta
aatcatactggcgcacataaaataaataatgcgatcggccaagcacttttagcaaagcgt
atggggaagaaaaagattgtcgctgaaacaggggcaggtcagcatggtgtcgcaacggca
actgcgtgtgcattgcttgatatggaatgtatcgtttatatgggggcagaagatgtacgc
cggcagcaactgaacgttttccgtatggagctcctcgggacaaaagttgttgcagtagaa
aaaggttccgcaacattaaaagatgcggttaatgaagcattgcgtcactgggttactcat
atagaagatacgcattacattttaggatcagcacttgggccacaccccttccctacaatt
gtccgtgatttccagcgtgtcattggggatgaaacacgtgcccaaattttacaacaggaa
ggacgtcttccggatacagttattgcttgtattggcggcggcagtaatgcaatcggaatg
ttcttcccattcgtggaagatcaggatgttgcattatatggcgtggaagctgcaggttcc
ggtgttaataccgacaagcatgcggcagcaattcatgttggaaaaacaggcgtccttcac
ggtgcgttcatgtacttattgcaggatgataacggttttgttcaagaagcccattcaatt
tcagcaggacttgattatccgggagttggacctgagcactgtcatttacatgaaacaggt
cgtgctgcctacccttctgttaccgatgaacaggcacttgaaggtgtgaagctgttatgt
gaaacagaaggaatcttgcctgcattggaaagcgcgcatgccatttactatgcaagtcaa
tttgccaagaaccgtcctgctgatgaaattgttgttgtttgcttatcaggtcgtggagac
aaagatgttcatacattaatggataaacttggaggtggcttgaaatga

DBGET integrated database retrieval system