KEGG   Solibacillus silvestris: SSIL_3454Help
Entry
SSIL_3454         CDS       T02162                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
siv  Solibacillus silvestris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSIL_3454
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSIL_3454
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSIL_3454
Enzymes [BR:siv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSIL_3454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3575675..3576454
Genome map
AA seq 259 aa AA seqDB search
MTLQKQLEDVLATGDKAFVPYIMAGDGGLETLKPTILKLQQIGVSAIEVGIPFTDPVADG
PTIEQAGERALAHGVSLKKVLAELQSFAQEIHIPLVVMTYLNPILAYGIEAFAEDAKRGG
VQGLIVPDMPYEESALLHDALKVNGIALVQLVSLMSPPDRIKKLAAASEGFVYAVTVNGI
TGERASFAAELAGHFANLKAASNIPVLAGFGISTTEHVKSFGDIADGVIVGSKIVTALVE
QDWATIEALVQATKKTAAI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacattgcaaaaacagctcgaagacgtattagcaacaggggataaagcatttgttcct
tatattatggcaggcgatggcgggcttgaaacgttaaaacctactatattaaagctgcag
caaatcggggtttccgcaattgaggtcggcattccatttaccgatcctgtagcagatgga
ccaacgattgaacaagccggtgaacgtgcacttgcccacggtgtgtcattgaaaaaagta
ctagctgaactgcaaagctttgcacaggaaatccatattcccctcgttgtcatgacttac
ttaaacccgattttagcttatggaattgaagcatttgccgaggatgcaaaacgcggtggt
gttcaagggctgattgtaccggatatgccttatgaagaaagtgctttattgcatgatgct
ttaaaggtaaacggcattgcgcttgtccagctcgtatcattgatgagcccacctgatcgt
attaagaaattagccgcagcaagtgaaggcttcgtttatgccgttacggtaaatggtatt
accggtgaacgtgcaagctttgccgcggaacttgctgggcactttgcaaacttgaaagca
gcgagcaatattccggttctagcaggattcggtatttctacgacggaacatgtaaaaagc
ttcggcgacattgcggatggcgtaattgtcggcagtaaaattgttacggcactcgttgag
caagactgggcaacaatagaagcccttgtacaggcgacgaagaagacggcggcaatttaa

DBGET integrated database retrieval system