KEGG   Solibacillus silvestris: SSIL_3454Help
Entry
SSIL_3454         CDS       T02162                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
siv  Solibacillus silvestris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSIL_3454
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSIL_3454
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSIL_3454
Enzymes [BR:siv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSIL_3454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3575675..3576454
Genome map
AA seq 259 aa AA seqDB search
MTLQKQLEDVLATGDKAFVPYIMAGDGGLETLKPTILKLQQIGVSAIEVGIPFTDPVADG
PTIEQAGERALAHGVSLKKVLAELQSFAQEIHIPLVVMTYLNPILAYGIEAFAEDAKRGG
VQGLIVPDMPYEESALLHDALKVNGIALVQLVSLMSPPDRIKKLAAASEGFVYAVTVNGI
TGERASFAAELAGHFANLKAASNIPVLAGFGISTTEHVKSFGDIADGVIVGSKIVTALVE
QDWATIEALVQATKKTAAI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacattgcaaaaacagctcgaagacgtattagcaacaggggataaagcatttgttcct
tatattatggcaggcgatggcgggcttgaaacgttaaaacctactatattaaagctgcag
caaatcggggtttccgcaattgaggtcggcattccatttaccgatcctgtagcagatgga
ccaacgattgaacaagccggtgaacgtgcacttgcccacggtgtgtcattgaaaaaagta
ctagctgaactgcaaagctttgcacaggaaatccatattcccctcgttgtcatgacttac
ttaaacccgattttagcttatggaattgaagcatttgccgaggatgcaaaacgcggtggt
gttcaagggctgattgtaccggatatgccttatgaagaaagtgctttattgcatgatgct
ttaaaggtaaacggcattgcgcttgtccagctcgtatcattgatgagcccacctgatcgt
attaagaaattagccgcagcaagtgaaggcttcgtttatgccgttacggtaaatggtatt
accggtgaacgtgcaagctttgccgcggaacttgctgggcactttgcaaacttgaaagca
gcgagcaatattccggttctagcaggattcggtatttctacgacggaacatgtaaaaagc
ttcggcgacattgcggatggcgtaattgtcggcagtaaaattgttacggcactcgttgag
caagactgggcaacaatagaagcccttgtacaggcgacgaagaagacggcggcaatttaa

DBGET integrated database retrieval system