KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_0374Help
Entry
YG5714_0374       CDS       T00901                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_0374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_0374
   00020 Citrate cycle (TCA cycle)
    YG5714_0374
   00620 Pyruvate metabolism
    YG5714_0374
   00640 Propanoate metabolism
    YG5714_0374
   00650 Butanoate metabolism
    YG5714_0374
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YG5714_0374
   00680 Methane metabolism
    YG5714_0374
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    YG5714_0374
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     YG5714_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(331398..332555)
Genome map
AA seq 385 aa AA seqDB search
MQVLKRKTLALVGNHAVAYAVKQSKPQVLAVFPITPQTTMLEKISEYIASEELNAELIKV
ESEHSALASIYGAALAGARVFTATSSQGLLYMTEMIYWAGGQRVPMVAAVATRAIAEPWS
IWDDHQDFLSKRDAIWIQMMAENVQEAYDMTIQAFRISEDERVILPVMMGFDGFILTHTM
ERIEVLEDGEVDNFLPPRQFNLIDFSDPIGVGPIATPEDYIKYRYEAMKAMERAKGVIEE
VMNEYERISGRKQNGLVECYKCEDAKYVFVTMGAWSGDCKVAVDRLRDAGVEAGLLKIRV
FRPFPKEKIEEYLRSMKGVIVLDRAYSYGSGGILANEIKATLYGYRVPVYSVIAGIGGKD
VRPRHFQKVIEDLINDNLEEERWLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttttaaagaggaaaactttagctttagttggtaatcacgcagttgcttatgct
gttaagcaatctaaacctcaagttttagcggtgttcccaataactcctcaaactacaatg
ctagagaaaatttccgaatacatagcttctgaggaattaaatgctgagttaataaaggtg
gaaagtgagcattctgcgttggcttcaatttatggtgctgcattggctggtgctagagtt
ttcactgcaacgtcttctcaaggactactatacatgactgagatgatatattgggctgga
ggtcaaagagtccctatggttgctgcagttgcaactagggcaattgcagagccttggagt
atttgggatgatcatcaagatttcctaagtaagagagatgcaatttggattcaaatgatg
gcagaaaacgttcaagaggcttacgatatgacaatacaagcgtttagaatttcagaagat
gagagagtaatcttaccagtcatgatgggatttgatggcttcatattaactcacacaatg
gaaaggattgaggtattagaggatggtgaggttgacaactttttaccgcctagacaattt
aacctaattgacttctctgatcctattggtgttggaccaatcgcaactccagaggattac
atcaagtataggtatgaggctatgaaggccatggaaagagctaaaggggttattgaggaa
gtaatgaatgaatacgagaggataagtggaaggaaacaaaacggtttagttgagtgttat
aaatgtgaagatgccaaatacgttttcgttaccatgggagcgtggagtggtgactgtaag
gttgctgtggatagactaagggatgctggggttgaggctggattgctcaaaatcagagta
tttagaccattcccaaaggagaaaatagaggaatacttaaggtcaatgaaaggtgtaata
gttctcgatagagcttattcgtatggttctggggggattttagcaaatgagataaaagct
acactttatggctatagagtaccagtttacagcgtaatagcaggtattggtggaaaggac
gttaggccacgtcacttccaaaaggtgattgaagacctaatcaacgataatttggaagag
gagaggtggttgttgtga

DBGET integrated database retrieval system