KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_0375Help
Entry
YG5714_0375       CDS       T00901                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_0375
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_0375
   00020 Citrate cycle (TCA cycle)
    YG5714_0375
   00620 Pyruvate metabolism
    YG5714_0375
   00640 Propanoate metabolism
    YG5714_0375
   00650 Butanoate metabolism
    YG5714_0375
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YG5714_0375
   00680 Methane metabolism
    YG5714_0375
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    YG5714_0375
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     YG5714_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(332559..332828)
Genome map
AA seq 89 aa AA seqDB search
MLIKVPMGVPVARPRIGSAGKTGLWRVEKPVIDYNKCTKCRLCVIYCPENTIDLLENLYP
QIDYDYCKGCGVCAQVCPPKAIDMVREVK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
gtgttgattaaagtccccatgggagtaccagtagctaggccaaggataggatctgcggga
aaaactggattatggagagttgagaaaccagtaattgattacaataagtgtactaagtgt
agactttgcgtaatttattgcccagaaaatactattgatctcctagagaacctctatcct
caaattgattatgattattgtaaaggttgtggtgtttgtgcacaagtttgcccacctaag
gcaatagatatggttagggaggtgaagtga

DBGET integrated database retrieval system