KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_0392Help
Entry
YG5714_0392       CDS       T00901                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YG5714_0392
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_0392
  Lipid metabolism
   00071 Fatty acid degradation
    YG5714_0392
  Amino acid metabolism
   00350 Tyrosine metabolism
    YG5714_0392
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YG5714_0392
   00626 Naphthalene degradation
    YG5714_0392
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YG5714_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
347584..348627
Genome map
AA seq 347 aa AA seqDB search
MRAVRLVEIGKPLVLKDIDIPKPKGAQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGV
KLPVTLGHEIAGKIEEMGDEVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGI
NFDGAYAEYVLIPHYKYMYKLRRLNAVEASPLTCSGITTYRAVRKASLDPTKTLVVVGAG
GGLGTMAVQIAKAVGGATIIGVDVREEAVETAKRAGADYVINASVQDPLAEIRRITEGKG
IDAVIDLNNSEKTLSVYPKALAKQGKYIMVGLFGADLHFHAPLITLSEIQFVGSLVGNQS
DFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAVGRQVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttagattagtagaaataggaaaacctctcgttttaaaagatatagatata
cctaaacctaagggagcacaagttttgataaaggtagaggctgcgggagtttgtcattct
gatgttcacatgagacaagggagatttgggaatttaagaatagtagaagatttgggtgtg
aaattgccggtaactttaggtcacgagatcgcaggaaaaatagaggaaatgggagatgaa
gttgttggatactctaagggtgatctagttgcagttaatccttggcagggagaaggaaat
tgctattattgtagaataggggaagagcatttgtgcgattctcctagatggttaggaatt
aactttgatggagcttacgcagaatatgtgttaatacctcattataaatatatgtacaag
ctgagaagacttaatgccgtagaagcatcacctttaacttgttctggaataactacatat
agggcagttagaaaagcatcattagacccaactaagacattagtagtagtaggggctggt
ggcggtctaggaacaatggcggtacagatagctaaagctgtcggtggtgcaacgataata
ggtgtagatgtgagagaggaggcagtagagactgctaagagagctggagccgattacgta
ataaatgcgtcagttcaagatcccttagcggaaataaggagaataaccgaaggtaaggga
atcgacgctgtaatagacctaaataactctgagaaaacgctttcagtttatccaaaagct
ttggcaaaacaaggtaagtacataatggtgggattattcggagcggatttgcattttcac
gcaccattaataactttgtcagaaatacaattcgtaggcagtttagttggaaaccaatca
gactttttggggataatgagattagcagaggctggtaaagttaaaccaatgataactaag
accatgaaactagaagaggcaaatgaggcgattgataatctagagaattttaaagctgtc
ggaagacaagtacttataccataa

DBGET integrated database retrieval system