KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_0584Help
Entry
YG5714_0584       CDS       T00901                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
siy00010  Glycolysis / Gluconeogenesis
siy00620  Pyruvate metabolism
siy00640  Propanoate metabolism
siy00680  Methane metabolism
siy00720  Carbon fixation pathways in prokaryotes
siy01100  Metabolic pathways
siy01110  Biosynthesis of secondary metabolites
siy01120  Microbial metabolism in diverse environments
siy01130  Biosynthesis of antibiotics
siy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_0584
   00620 Pyruvate metabolism
    YG5714_0584
   00640 Propanoate metabolism
    YG5714_0584
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YG5714_0584
   00680 Methane metabolism
    YG5714_0584
Enzymes [BR:siy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YG5714_0584
Lipid biosynthesis proteins [BR:siy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YG5714_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACP44879
JGI: SislY10584
UniProt: C3NB94
Position
complement(550315..551949)
Genome map
AA seq 544 aa AA seqDB search
MLEVDLREIRFHSYDELVRTFKWNIPSHFNIGESILDRKIKEGLGDNIAIYYEDEEGNHF
AYTFTQLKNLSDSLITILREIGVKRGDVVGIYLQPRVETVISILSLYRLGAISLSISPLM
GVESVEYRIRQSDAKAIIIEGSRREVRQKLRNITKIIVADSARDESEINFDEVKRTSGVY
YAVDTKSDEPAQLFYTSGSTGAPKGVLHAHRFLLGHIPAYQLYFEMAPKEEDVFYTPADW
GWIGAIGDVLLPSLYFGKPIVAYRRLGKFSPKDALAIMQKYKVTCAFIPPTALRMIRREV
INPRRDYDLRLRAISSAGEAVGEDLLEWAIKKLSPNVNEFYGCTEANLVTVNNSMWRKIG
SIGKATPGHEIAVIDEKGNKVINQVGEIAVRMEDPVLFLGYYKDPEATAKKFRGYWFLMG
DLGLMDQNGYIWFKGRGDDVIKVSGYRLGPEEIESVILQHSAVQEVAVIGKQDKLRGNII
KAFIVLKDGYLPSDNLVQEIQEFVKNRLALYAYPREIEFVKELPRTETGKLKRFELRKKE
EEKS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaggtagatttgagagaaattagatttcatagttatgatgagctcgtaagaaca
ttcaaatggaatattccatcacactttaatataggagaatcgatattagacagaaagatt
aaggaagggttaggagataacatcgcaatatactatgaagacgaggaaggtaatcatttt
gcttatactttcactcaattgaagaatcttagcgattctttaataacaattttaagagaa
ataggagtaaaaagaggggatgtcgttggtatttacttacagcctagggtggaaactgta
ataagtattttatcgctatatagacttggagcaattagtttgtcgatttcaccattaatg
ggtgtagagtctgttgaatatagaataaggcaaagtgatgccaaggccataataattgaa
ggttcaagaagagaggttagacagaaattaaggaatataactaagatcatagttgctgat
agtgctagagatgaaagtgaaattaatttcgatgaggttaaaaggacctctggagtgtac
tatgcggtagatactaagagcgatgaaccagcccagctcttttatacatctggtagtact
ggggcaccaaagggagtccttcatgctcacaggtttctgttgggacatattccagcttat
cagctctattttgaaatggcaccaaaagaagaggatgtattttacacgcccgcagattgg
ggttggattggagctataggtgacgtgctattgcctagcctctattttgggaagccaata
gtagcatatagacggctagggaaattctcacctaaagacgcactagccataatgcagaaa
tataaagttacttgtgctttcatccctcctactgctttaagaatgattagaagggaagtt
attaatccaaggagagattatgacttaagattaagggcaattagtagtgctggagaggct
gtgggagaggatctgcttgagtgggcaatcaaaaaattgtctcctaatgttaatgaattt
tatggctgtacagaggctaatttagttaccgtaaataactccatgtggcgtaagatagga
tctataggcaaagctactcctggtcatgagatagcagttattgatgaaaaaggcaataag
gtaataaatcaagtgggagaaatagcagtaaggatggaagacccagtattgtttctagga
tattacaaggatccagaagctactgctaagaagtttaggggatattggttcttaatggga
gatctaggtttaatggatcaaaatgggtatatttggtttaaagggagaggagacgacgta
ataaaggtttctggatatagattaggaccggaggagatagagagcgtaatattacaacat
tccgcagttcaagaagttgcggtaataggtaagcaagataagttgagaggaaatataatt
aaggcatttatagtactaaaggatggatatttgccatctgataacttagtacaagaaatt
caggaatttgtcaaaaatagactagctttatatgcatatcctagagaaatagaattcgtt
aaggaattacctagaaccgagactggtaaattaaagagatttgagctaagaaaaaaagaa
gaagaaaaaagttga

DBGET integrated database retrieval system