KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_0775Help
Entry
YG5714_0775       CDS       T00901                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_0775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_0775
   00620 Pyruvate metabolism
    YG5714_0775
   00640 Propanoate metabolism
    YG5714_0775
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YG5714_0775
   00680 Methane metabolism
    YG5714_0775
Enzymes [BR:siy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YG5714_0775
Lipid biosynthesis proteins [BR:siy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YG5714_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(722295..724046)
Genome map
AA seq 583 aa AA seqDB search
MWERKRYINRRGILLYMRNMVEIIREKKIILRPNLENYEEVRKNFSWSKIREELNYNGDV
NAAELAIHKKGELGDKYGILWVSEDDEKRKYTFRDLEKRGATFRRVLEDNGVRSGDRVVI
MSKRVPALYFSFVAIGMLGSVILPIFSTFGEDAIRYRVENSGAKVAIVHESLVEKFRNIH
GIKILKITDDGIEGESNRGVESSYTRRSINDPFLILYTSGTTGKPKGIWHSQDILTFYYV
SGKYHFDMHPQDVFWHTGDPAWVAGFAGVWTAWVNGIPLVSYEGRFKAETWYSNIQEYRV
SVISTAPTALRLLKKEGLELAKKYDLSSVRFVHAGGEYVDPDTVKAGIEIFGVPVHDGYG
QTETATYVIANFISMPIKIGSMGKPLPGVEAVIVDENGNTLPPNTQGILALKPDFPAMAR
GIWGDEERWKRNFKNGYYLTGDTAYVDEDGYFWYLGRSDDVIKVSGYRVSPIEIESVIAT
HPAVAEAGVIALEDPVRGHKIKAYIVLKKNYEPSEELKQQIQNYVRERLAAHMVPREIEF
VSELPHTLSGKIMRRVLKAMESGREVGDISTLENPEIVKKSKK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaagaaaaagatatataaataggagaggtattttattgtatatgaggaacatg
gtagagattataagggagaagaagataattttaagacctaatctggaaaactatgaagaa
gttaggaagaactttagttggagtaagataagagaagagttaaattataatggtgatgtc
aacgcagcagaactggcaatacataagaaaggtgaactaggagataaatacggtatccta
tgggttagtgaggatgatgaaaaaaggaaatatacttttagagatttggaaaagagaggt
gctacattcagaagagttttggaggataatggggtaaggagtggcgatagggtagtaatt
atgtctaaaagggtcccagcgctctacttctcctttgtagcaataggaatgttgggtagc
gttatacttcccattttctccacatttggtgaagacgcaataaggtatagggttgaaaat
agtggtgctaaagttgcaatagtgcacgagtcgttagtggaaaagtttaggaacattcat
gggattaagattttgaagattacagatgacggcatagagggagagagcaataggggagtc
gagtcttcatacactaggaggtctattaatgatccatttttgatcttatatacctctggg
actacgggaaagcctaaaggtatttggcactctcaagatatattgacgttttactatgta
tcgggtaaatatcatttcgatatgcatccccaagatgtcttctggcatactggagaccct
gcgtgggtagctggatttgctggagtttggaccgcgtgggttaatggtatacccttagtc
tcctatgagggcaggtttaaagctgagacgtggtatagtaatattcaagagtatagggtt
tcagtaatttcaactgccccaactgccttgaggttgttgaagaaggagggattagaatta
gccaaaaaatacgatctctcctcagttagatttgtccacgctggaggagagtatgttgat
cctgataccgtgaaagcgggaattgagatattcggtgttccagttcacgatggatatggg
caaacggaaactgcaacttacgttatcgctaacttcatttcaatgccgataaaaattggt
tccatgggaaagcccctccctggagttgaagctgtgatagtggacgagaacgggaatacg
cttcctccaaatacacaaggtatactagctctaaagccggattttccagccatggctaga
ggtatatggggagacgaggagaggtggaaacgtaacttcaagaatggatattacttaact
ggagacacagcgtatgttgatgaagatggatacttctggtatttagggagatccgatgac
gtgattaaggtatctggatatagggttagtccaatagagatagagagtgtaattgcgact
catcctgctgtggcggaagctggagttatagctttagaggatccagttagagggcataag
atcaaggcatatatagttctcaagaagaactatgaaccatctgaagagcttaaacaacag
atccaaaactacgttagggagagattagctgctcacatggtacctagggaaatagagttt
gtaagcgaattacctcatacattgagtggaaaaataatgaggagagtattgaaggctatg
gaaagtggtagggaggtaggtgatattagcactttagaaaacccagaaattgtaaagaaa
tcaaaaaaataa

DBGET integrated database retrieval system