KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_0799Help
Entry
YG5714_0799       CDS       T00901                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
siy00010  Glycolysis / Gluconeogenesis
siy00020  Citrate cycle (TCA cycle)
siy00620  Pyruvate metabolism
siy01100  Metabolic pathways
siy01110  Biosynthesis of secondary metabolites
siy01120  Microbial metabolism in diverse environments
siy01130  Biosynthesis of antibiotics
siy01200  Carbon metabolism
Module
siy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_0799
   00020 Citrate cycle (TCA cycle)
    YG5714_0799
   00620 Pyruvate metabolism
    YG5714_0799
Enzymes [BR:siy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YG5714_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT Peptidase_M23 Transferase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ACP45084
JGI: SislY10799
UniProt: C3NC76
Position
complement(745790..746974)
Genome map
AA seq 394 aa AA seqDB search
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTAVKAVASGILLKIY
AKEGEEVPVGQIIAYIGEIGEKPPSLSTKPTLVSEQQQGQSTRIEEAKAISEVRASPRAR
RLAKEKGIDLVKIKGTGPGGMITEDDVIRELENIEKGVKFTATGLRVKEVIPMTAIRQEI
SRRMVQSLQTMAQVTLNIEINANSLVKIKNEVESKYSMKITYTDVLVKVVAKLIRSHPFL
NATLEGDQIKIIEDVNIGIAVALDQGLIVPVIRNADIKPITEIVKESHELADKARENKLN
PDEVTGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRKAPVVIGDNISIGYVMWLSL
TFDHRVLDGHTAAKFLKELTEILEDQNRLRAFLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaagtattaatgccaaagttaggtttaaccatgactaaagggaaaatagtt
caatggaagaaaaaagaaggagatagagttcaagaaggagaggacttagtaataatagaa
actgagaaaataacaactgcagtaaaagcagtagctagcggtatcttacttaagatttac
gccaaagaaggtgaagaggtacctgttggtcaaataatagcgtacataggtgaaattgga
gaaaaacccccatccttatctactaaacccactttggttagtgaacagcaacaagggcaa
tcaactcgaattgaagaggctaaggcaataagtgaagtaagagcttcacctagagctaga
aggcttgctaaagaaaaaggaatagatctagttaaaataaaggggactggacctggaggt
atgataacagaagatgatgtaattagagagttagaaaatattgaaaaaggagtgaaattc
actgccactggtcttagagttaaagaagtgataccaatgactgcaataaggcaagaaata
agcagaagaatggttcagagccttcagacaatggcccaagtgacactaaatattgagatt
aatgcaaattcgttagttaaaataaaaaatgaagtagagtctaagtatagcatgaaaatt
acttatacagacgttctagttaaagtagtagctaaactcatcagaagtcatccatttcta
aacgcaacactagagggcgatcaaataaagataattgaggatgttaatataggaatagct
gtggctctagatcaaggattaatagtaccagtaataaggaacgcagatattaagccaatt
actgaaatagtaaaagaaagtcatgaactagcggataaggctagagaaaacaagttaaat
cccgacgaagtaacaggaggaacgtttacgataagtaatttaggaatgtatgatatagat
tcatttacaccaattataaatcctcctcaaactgctatattgggagtaggtaggataaga
aaggcaccagttgtaataggcgataatatctcaatcggttacgttatgtggctaagttta
acatttgatcatagagtgttagatggacataccgctgctaagttcttgaaagagcttact
gaaatattagaggatcagaatagattgagagcgtttttaagttag

DBGET integrated database retrieval system