KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_0831Help
Entry
YG5714_0831       CDS       T00901                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_0831
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_0831
   00620 Pyruvate metabolism
    YG5714_0831
   00640 Propanoate metabolism
    YG5714_0831
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YG5714_0831
   00680 Methane metabolism
    YG5714_0831
Enzymes [BR:siy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YG5714_0831
Lipid biosynthesis proteins [BR:siy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YG5714_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
778474..780021
Genome map
AA seq 515 aa AA seqDB search
MKYEELVRNFSWNEVKNYFGKDFRDKLIRDSSDTAVFRVDSKWDKESLSYSQLKDKAQRL
SAFLRHQFKVKKGDVVACLASKKVEQVVYLVSSWILGVIYEPLFTAFGPAAIEMRTRDRK
PKVILAQDDQYDKIKDMFNNIITFPGKTGNSVSLDEAISYDMLRREEWEKISYDDPSGLQ
YTSGTTGRPKGALQNFRTLYSLYVYIKYGIGLREDDVFWTPADPGWAYGLGVGIISPIIF
GKTVIFFDKLFSPEDTLKFIEDFKISNFAFVPTAYRMIMGTVKEPKKFNLRITRASSAGE
PLNPEVIRWFKENLDFMIKDHYGQTESGMVVYNGWGYEADVKPGSMGLPAPGYQVTVIDG
VIAVNKNCEGFYFLGYINDEERTKKVFKGDWYLTGDAAEIDKDGYFWFIGREDEVIKVSG
YRASPFEIESVLIQHPAIMEAAVIGVDDPVKGKIIKAYVVLKPNYKPSDDLANEIINFVR
EKYSRHAYPREVKFVTSLPKTESGKIQKYKLKELG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgaagaattagtcagaaattttagttggaatgaggtaaaaaattactttggc
aaggattttagggataagttaataagggatagtagcgatacagcagtattcagagtagat
agtaaatgggataaggaatccctatcatactcccaattaaaagacaaagctcagagacta
agtgcgtttttaagacatcaatttaaggtaaagaaaggtgacgtagtagcttgtctagca
tctaagaaagttgaacaagtagtttatttagtttctagctggatattaggagtaatatat
gagcctttattcacggctttcggacctgctgcaatagagatgaggactagagatagaaag
cctaaagttatactagcacaagatgatcagtacgataaaatcaaggacatgttcaataat
ataattacatttccaggaaagacaggaaattctgtatcccttgatgaagccatatcttat
gatatgttgaggagagaggaatgggagaagatctcatacgacgatccctctggcttacaa
tacacttctggtactacggggaggcctaagggagcattacaaaacttcagaacactttat
agcctatatgtttacataaagtacggtattggtttaagagaagatgacgtattctggact
ccagcagacccaggttgggcttatggcctcggagtagggataatatctcctataatattc
gggaaaactgtaatatttttcgataagctattctctcctgaagatactctgaaattcatt
gaagattttaaaatttctaatttcgctttcgtgccaactgcttataggatgataatggga
actgtaaaagagcctaaaaaatttaacttaaggattactagagctagctctgcaggagaa
ccattaaatccagaagttataaggtggtttaaggaaaatttagacttcatgatcaaggac
cattacggtcaaactgaatctggaatggtagtttataacggctggggttatgaggctgac
gttaaaccgggcagtatgggattacctgcaccaggatatcaagtcactgtaatcgatgga
gtaatagcagttaacaagaattgtgagggattctatttcttaggttatataaatgacgaa
gagagaactaagaaggtatttaaaggagattggtatttaaccggtgatgctgcagaaata
gataaggatgggtacttctggttcatcgggagagaggatgaggtaataaaggtgtcagga
tatagggcgagtccatttgaaatagaaagtgttctaatacaacatcctgcaattatggaa
gcagcggtaataggagtagatgacccagttaagggaaagataattaaagcttacgtagtt
ttaaagccaaattataaaccctcagatgacctagcaaatgagataattaacttcgtaagg
gaaaagtactcaagacatgcatatccaagggaagtgaaattcgttacctcacttcctaag
actgagagcggtaaaatacaaaaatataagctgaaagaattaggatga

DBGET integrated database retrieval system