KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1014Help
Entry
YG5714_1014       CDS       T00901                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_1014
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_1014
   00620 Pyruvate metabolism
    YG5714_1014
   00640 Propanoate metabolism
    YG5714_1014
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YG5714_1014
   00680 Methane metabolism
    YG5714_1014
Enzymes [BR:siy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YG5714_1014
Lipid biosynthesis proteins [BR:siy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YG5714_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(946222..948090)
Genome map
AA seq 622 aa AA seqDB search
MSWKIYSLDQIKALAKFSMENPEAFWRDKANYITWFRQPEKILEGEPPYEKWFVGGTTNI
SYNAIDRHLPDKKDKVAFYWTNERLDSFRSISFQDLYQEVNKAAYVLSELGVKKGDTVSM
LMPNIPEAVYFSLATHRLGAILIIHYVGLSEETVAYRFNDCGSKVLIVASKTFRNGNEIR
IKDFVDKVLESHTTPIQKVLAVPRGYSDFNVNGKRDVVYDDVKPKGKVYVKPVEVEANEP
ATVYYTSGTTGRPKGLYHSNGGYVIALNWAFKAIFNPTENDVWWTVSELGWPVWPMANLY
TIPVMGIPGVLFEGYVGYKRDLFSRVIERYNVSLVWSSTTTLYTLKSLGEESVKSGDTSS
LRMILNTGEPLNVGAWMWLNQNLPQVKIADAYWMTEHLSPVGATPYGIGEIPFKAGSAGI
QFPGGTYFLIVDDEGKPLPPKQKGYIVLKPLNPALAKMWNDPNYEKIKEKYWSRFPGYFY
TGDYGYVDEDGYLFVLGRADDVIRAEGERIGTLEVESVIVTHPNVAEAAVIGQGGNIIAF
VVPRQGVEVGDALRNDIKNYCRNAGYIVDKVVFVKRLPKTKSGKIMRRLLKAILANENPG
DVSTLDDIRIMEELKEALKSLS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagttggaaaatatattctctagatcagattaaagcattggcgaaattctctatggaa
aatccagaagccttctggcgagataaggctaattacataacttggtttaggcaaccagag
aaaatacttgagggagaaccaccgtacgagaagtggttcgttggaggaaccacaaatata
tcctataacgctatagataggcatttaccagataagaaagataaggtggcattttattgg
accaatgaaagattagatagttttaggtcaatatcctttcaagatctttatcaagaagta
aacaaggcagcctatgtcttaagtgaattgggcgtgaaaaaaggcgatacggtatccatg
ctaatgcctaatataccagaagctgtatacttctccttagcaacacacagactgggggca
attctaataatacattatgtaggtttgagcgaggaaacagtggcatataggtttaatgat
tgcggttcaaaagtattgattgttgcttcaaagacgtttaggaatggaaatgagataaga
attaaggattttgtggataaagttttggaatctcatactacacccatacagaaagtcttg
gcagtgccgaggggatattcagattttaatgttaatgggaaaagggatgttgtgtatgat
gatgtgaaacctaaagggaaagtttacgttaaaccagtggaagttgaggctaacgagcca
gcgacagtttattacacgtctggaactacgggaagacctaagggattataccatagtaat
ggagggtatgtgatagcactcaattgggcttttaaggcaatatttaacccaacagagaat
gacgtttggtggactgtttcagaattaggttggccagtatggccaatggcaaatttatac
acgataccagtaatgggaatacctggtgtgctttttgagggatatgttggttataaaagg
gatctattctcgagagtaattgagagatataatgtaagcctagtttggagttctaccaca
actctttacactctcaagagtttaggagaggagtcagttaagagcggagatacatcaagc
ttaagaatgattcttaatacaggagaacctttaaacgttggagcgtggatgtggttaaat
cagaatcttcctcaagttaagatagcagatgcgtactggatgacagagcatttatcgcca
gttggtgcaactccttacggaatcggcgaaattccctttaaggcaggttccgctggtata
caattcccaggaggaacatatttcttaattgttgacgatgagggaaaaccattacctcct
aagcaaaaggggtatatagtgttaaaaccgcttaacccagccttagctaaaatgtggaat
gatcccaattacgagaagataaaggagaagtattggtctaggttcccaggatacttctac
actggagattacggttatgttgatgaggatggatatctgttcgtgctgggaagagctgat
gatgtaataagagctgaaggggagaggataggaacacttgaagttgaaagtgtaatagta
actcatcccaacgtggccgaagctgccgtaataggtcaaggcggtaacataatagcgttt
gtagtcccaagacaaggggttgaggttggtgacgcactcagaaatgacattaagaactat
tgtaggaacgctggttacatagttgataaagtagtgtttgtgaagagactgcctaaaacc
aaaagcgggaagataatgagaaggctactaaaggctatcctagctaacgagaatccaggt
gatgtatcaacattggacgatataaggataatggaggaacttaaggaagcgttgaagagc
ctaagctaa

DBGET integrated database retrieval system