KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1310Help
Entry
YG5714_1310       CDS       T00901                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding subunit
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_1310
   01230 Biosynthesis of amino acids
    YG5714_1310
  Energy metabolism
   00680 Methane metabolism
    YG5714_1310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YG5714_1310
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     YG5714_1310
Exosome [BR:siy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YG5714_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1226545..1227516)
Genome map
AA seq 323 aa AA seqDB search
METIQGINSINKLDFKVLITDPVDQYMIKTLQNNGLIVDYKPEISREELLKIIDQYQVLV
VRSRTKVDKEIIRYGTNLKIIARAGIGLDNIDTEEASKRNIKIVYAAGASTDSAAELTIG
LLLTAARKLYDSMNMAKGGIFKKIEGIELAGKTIGVIGFGRIGTKVAKVCKALDMNVIAY
DVIDIKEKANMLGVKVAESLDELLKNSDVITFHVTVGKDAKPILNKDTFNYVKDNTIIIN
TSRAVVIDGKALLEYIDKKQLTYATDVLWNEPPKEDWEIKLLRHERVIVTTHIGAQTKEA
QYRVAVVTTDNLITSLKEIGVLK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatacagggtataaactctataaacaaattagatttcaaagtattaataact
gatccagtagatcaatacatgataaaaactttacaaaacaatggattaatagttgactat
aaacctgaaatttcaagagaggaattactaaagataatagaccagtatcaggttttagta
gtaagaagcagaactaaggtagataaggagataatccgttatgggactaatcttaagatt
atagccagagccgggatagggctagacaatatagatacagaagaggcatccaagagaaat
ataaaaatagtatatgcagcaggggcttctacagattctgcagcagaactaactatagga
ttacttcttacagcagctagaaaactatatgattccatgaatatggcaaagggtggcata
ttcaagaaaatagagggaattgagttagcaggtaagactataggtgttataggattcggt
cgaattggtaccaaagtagctaaggtatgtaaggcattagatatgaacgtaattgcgtat
gatgttatcgatataaaagaaaaggcgaatatgcttggagtcaaggtagctgaaagttta
gacgaattgttaaagaactcagacgtaataacctttcacgttacagtaggtaaagacgct
aaaccaatccttaataaagatacatttaattacgtcaaagataatacaatcataatcaac
accagtagagccgtagtaatagatggtaaggcattactagaatatattgataaaaagcaa
ctaacttatgctacagacgttttgtggaacgaacctcctaaagaagattgggagattaaa
ttattgagacatgagagagtgatagtaactactcacattggtgctcaaactaaagaagca
cagtatagagtagcagtagtcacaacagataatctcatcacttctttaaaagaaatcggt
gttctcaaatga

DBGET integrated database retrieval system