KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1310Help
Entry
YG5714_1310       CDS       T00901                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding subunit
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:siy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:siy01230]
Metabolism; Energy metabolism; Methane metabolism [PATH:siy00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:siy00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1226545..1227516)
Genome map
AA seq 323 aa AA seqDB search
METIQGINSINKLDFKVLITDPVDQYMIKTLQNNGLIVDYKPEISREELLKIIDQYQVLV
VRSRTKVDKEIIRYGTNLKIIARAGIGLDNIDTEEASKRNIKIVYAAGASTDSAAELTIG
LLLTAARKLYDSMNMAKGGIFKKIEGIELAGKTIGVIGFGRIGTKVAKVCKALDMNVIAY
DVIDIKEKANMLGVKVAESLDELLKNSDVITFHVTVGKDAKPILNKDTFNYVKDNTIIIN
TSRAVVIDGKALLEYIDKKQLTYATDVLWNEPPKEDWEIKLLRHERVIVTTHIGAQTKEA
QYRVAVVTTDNLITSLKEIGVLK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatacagggtataaactctataaacaaattagatttcaaagtattaataact
gatccagtagatcaatacatgataaaaactttacaaaacaatggattaatagttgactat
aaacctgaaatttcaagagaggaattactaaagataatagaccagtatcaggttttagta
gtaagaagcagaactaaggtagataaggagataatccgttatgggactaatcttaagatt
atagccagagccgggatagggctagacaatatagatacagaagaggcatccaagagaaat
ataaaaatagtatatgcagcaggggcttctacagattctgcagcagaactaactatagga
ttacttcttacagcagctagaaaactatatgattccatgaatatggcaaagggtggcata
ttcaagaaaatagagggaattgagttagcaggtaagactataggtgttataggattcggt
cgaattggtaccaaagtagctaaggtatgtaaggcattagatatgaacgtaattgcgtat
gatgttatcgatataaaagaaaaggcgaatatgcttggagtcaaggtagctgaaagttta
gacgaattgttaaagaactcagacgtaataacctttcacgttacagtaggtaaagacgct
aaaccaatccttaataaagatacatttaattacgtcaaagataatacaatcataatcaac
accagtagagccgtagtaatagatggtaaggcattactagaatatattgataaaaagcaa
ctaacttatgctacagacgttttgtggaacgaacctcctaaagaagattgggagattaaa
ttattgagacatgagagagtgatagtaactactcacattggtgctcaaactaaagaagca
cagtatagagtagcagtagtcacaacagataatctcatcacttctttaaaagaaatcggt
gttctcaaatga

DBGET integrated database retrieval system