KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1310Help
Entry
YG5714_1310       CDS       T00901                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding subunit
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_1310
   01230 Biosynthesis of amino acids
    YG5714_1310
  Energy metabolism
   00680 Methane metabolism
    YG5714_1310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YG5714_1310
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     YG5714_1310
Exosome [BR:siy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YG5714_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1226545..1227516)
Genome map
AA seq 323 aa AA seqDB search
METIQGINSINKLDFKVLITDPVDQYMIKTLQNNGLIVDYKPEISREELLKIIDQYQVLV
VRSRTKVDKEIIRYGTNLKIIARAGIGLDNIDTEEASKRNIKIVYAAGASTDSAAELTIG
LLLTAARKLYDSMNMAKGGIFKKIEGIELAGKTIGVIGFGRIGTKVAKVCKALDMNVIAY
DVIDIKEKANMLGVKVAESLDELLKNSDVITFHVTVGKDAKPILNKDTFNYVKDNTIIIN
TSRAVVIDGKALLEYIDKKQLTYATDVLWNEPPKEDWEIKLLRHERVIVTTHIGAQTKEA
QYRVAVVTTDNLITSLKEIGVLK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatacagggtataaactctataaacaaattagatttcaaagtattaataact
gatccagtagatcaatacatgataaaaactttacaaaacaatggattaatagttgactat
aaacctgaaatttcaagagaggaattactaaagataatagaccagtatcaggttttagta
gtaagaagcagaactaaggtagataaggagataatccgttatgggactaatcttaagatt
atagccagagccgggatagggctagacaatatagatacagaagaggcatccaagagaaat
ataaaaatagtatatgcagcaggggcttctacagattctgcagcagaactaactatagga
ttacttcttacagcagctagaaaactatatgattccatgaatatggcaaagggtggcata
ttcaagaaaatagagggaattgagttagcaggtaagactataggtgttataggattcggt
cgaattggtaccaaagtagctaaggtatgtaaggcattagatatgaacgtaattgcgtat
gatgttatcgatataaaagaaaaggcgaatatgcttggagtcaaggtagctgaaagttta
gacgaattgttaaagaactcagacgtaataacctttcacgttacagtaggtaaagacgct
aaaccaatccttaataaagatacatttaattacgtcaaagataatacaatcataatcaac
accagtagagccgtagtaatagatggtaaggcattactagaatatattgataaaaagcaa
ctaacttatgctacagacgttttgtggaacgaacctcctaaagaagattgggagattaaa
ttattgagacatgagagagtgatagtaactactcacattggtgctcaaactaaagaagca
cagtatagagtagcagtagtcacaacagataatctcatcacttctttaaaagaaatcggt
gttctcaaatga

DBGET integrated database retrieval system