KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1320Help
Entry
YG5714_1320       CDS       T00901                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YG5714_1320
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YG5714_1320
Enzymes [BR:siy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YG5714_1320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1234821..1235567)
Genome map
AA seq 248 aa AA seqDB search
MPRYLKGWLKDVVQLSLRRPSFRTSRQRPIISLNKRILEFNVRNVTAIIAEYKRKSPSGL
DVERDPIEYAKFMEKYAVGLSVLTEEKYFNGSYEILRKIASSVSIPILMKDFIVKESQID
DAYNLGADTVLLIVKILTERELESLMEYTRSYGMEPLVEINDEKDLEIALRIGAKFIGVN
SRDLETLEINKENQRKLLSMIPSDVIKVAESGISERNEIEELRKLGVNAFLIGSSLMQNP
EKIKEFIL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccacgttatcttaaaggatggcttaaagacgtcgtacaattatctttaagaaggccc
tcgtttaggacttcaagacaaagaccgattatttccttaaataaaagaattttggaattt
aatgtgcgcaatgtcacagctataatagctgaatataagcgcaaatctccctctggattg
gatgttgaaagagatccgatagaatatgcaaagttcatggaaaagtatgcagtaggtctt
agcgtactaactgaggaaaagtactttaatggttcatatgaaattttgagaaagatagcc
agttcagtttcaatccccatattaatgaaggattttattgtcaaggaatcacaaattgat
gatgcgtataacttaggtgcagatactgtattgctaatagtcaaaatacttactgaaaga
gaattagagagtttaatggaatataccagaagttatggtatggaaccattggtagagatt
aatgacgagaaggatttagaaatagcactaaggataggggccaagtttataggagttaat
tcaagagatctagaaacccttgagataaataaggagaatcagagaaagcttctatcaatg
ataccatcagatgtaataaaggtggcagaaagtggaatttctgagaggaatgaaatagag
gaattgagaaaattaggtgttaatgctttcctaattggatcctcactaatgcaaaaccca
gaaaagattaaagaatttatactataa

DBGET integrated database retrieval system