KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1325Help
Entry
YG5714_1325       CDS       T00901                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YG5714_1325
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YG5714_1325
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YG5714_1325
Enzymes [BR:siy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YG5714_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1239033..1239764)
Genome map
AA seq 243 aa AA seqDB search
MGKLLVVYMTLGYPNVQSFKDFIIGAVENGADILELGIPPKYAKYDGPVIRKSYDKVKGL
DIWPLITDIRKDVSVPIIALTYLEDWIDQLDNFLNMMRDVKLDGVLFPDLLIDYIDDLDK
FDGIIKNKGLKNVIFTSPSVPDLLIHKVSKISDLFLYYGVRPTTGVPIPVSVKQLINRVR
NLVENKLIVGFGLSSESDLRDTLSSGADGIAIGTAFIEEIEKNGVKSAINLVKKFRVILD
EYK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaactgcttgtcgtttatatgacgttaggttatcctaatgttcaaagtttcaag
gattttattattggggcagttgaaaatggagctgacatattagagcttggaattccccct
aaatatgccaagtacgatggtccagttataaggaagagttatgataaagttaaagggcta
gatatttggcctttaataacagatattaggaaagatgtcagtgttcctataattgcactt
acttacttagaggattggattgatcaactagataattttctaaatatgatgagagatgtc
aaactggatggagttctatttccagatttacttattgattatatagatgatttggataaa
tttgacggaataataaaaaataaaggattaaaaaatgttatttttacatctccttcagta
ccagatcttctaatccacaaagtctctaagattagcgatttattcttatattatggtgtt
agaccaactactggcgtacctataccagtatcagttaagcagttgattaatagagttaga
aatctagttgagaataagctaatagtgggatttggcctatcaagtgagtcagatttaaga
gataccttaagttctggtgccgacggaatagcaattggaactgctttcatagaagaaatt
gaaaagaatggcgtaaaatcagcaataaatttagttaaaaaatttagggtgatattagat
gaatataaatga

DBGET integrated database retrieval system