KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1334Help
Entry
YG5714_1334       CDS       T00901                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YG5714_1334
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YG5714_1334
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YG5714_1334
Enzymes [BR:siy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YG5714_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1247803..1248993
Genome map
AA seq 396 aa AA seqDB search
MKCLSCGYETEIDQDQILCPRCGGLLEIIVEPPKDFSFSKLRGRGVWRYKELIAGKYKNI
VSINEGNTPLIRSSNINDNLYFKFEGLNPTGSFKDRGMTVAVSSAVSLNYKTVIAASTGN
TAASAAAYAARAGIKSFIVLPKGKVALGKLAQSILYGSVILEVDGSFDVAMDAVMRLYKD
LKVVYPLNSFNPWRLEGQKTIAFEIAEELGVPDNVIVPVGNAGNIYAIWKGFNELVKTGV
INTIPRMIGIQAEGASPIATAIVKGKDSPDFVENPDTVATAIRIGKPVNWQKAMKAIRES
NGTAIAVSDSEILDAQKTLARKEGIGAEPASAAALAGYIKAINEKVVDKDEKTVLILTGH
SLKDPDSMTKAEAKRILVNPLHMEKIILGEINGSNS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttaagttgtggatatgaaacggaaatagatcaagatcagatattatgtcca
agatgtggaggactattggaaattatagtggaaccaccaaaggacttctctttcagcaaa
ttgagaggaagaggagtttggagatacaaagaactgatagcaggcaaatataaaaatatt
gtaagtataaatgaaggaaataccccgctaataagatcctcaaatataaatgataatctt
tattttaaattcgaaggacttaatcctactggaagttttaaggatagaggaatgacagta
gcagttagttctgcagtaagcttaaactacaaaaccgtaatagcagcatctactggaaac
actgcagcttccgcagctgcttatgctgcaagagcaggtataaagagctttatcgtctta
cctaaaggtaaggtagcattaggtaaattagctcagtcaatactttatggctcagttatt
ttagaggttgatggaagttttgacgttgctatggatgcggtaatgaggttatataaggat
ttaaaagtagtatatccattaaattcttttaacccatggagattagaaggacagaagaca
atagcatttgagatagcggaagaactaggagttccagataatgtgatagtcccagtaggc
aatgcgggcaatatttacgcaatatggaagggatttaatgagctagttaaaactggagtg
ataaatactattcccagaatgattggaatccaagctgagggagcatcaccaatagctact
gcaatagtcaaaggcaaagattctccagatttcgtagaaaatccagatactgtagctact
gcaataagaataggaaaaccagtaaattggcaaaaagcgatgaaagcaataagagaatcc
aatggaaccgcaatagcagtatctgattctgaaatattagacgcacagaagaccctagct
agaaaagagggcataggagctgagcctgcttcagcagctgccttagctggttacattaag
gcaataaatgaaaaggtagtagataaagatgaaaaaacagttttaatcctaacaggacat
tcattaaaagatcccgatagtatgaccaaagctgaagctaagagaatattagttaatcct
ctacatatggaaaaaattatcctaggtgagataaatggctctaatagttaa

DBGET integrated database retrieval system