KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1376Help
Entry
YG5714_1376       CDS       T00901                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K00096  
glycerol-1-phosphate dehydrogenase [NAD(P)+] [EC:1.1.1.261]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YG5714_1376
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.261  sn-glycerol-1-phosphate dehydrogenase
     YG5714_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1283562..1284617
Genome map
AA seq 351 aa AA seqDB search
MNVKEHVISLPRRVFVGHDIIYDISIYFSQLGITSPFLIVTGTKYTKKIADRVIENLPKN
AKYEVIEIDTATLDDVYKVEEVVKKVNPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTS
PSHDGITSPFASIKGLQKPVSVKAKEPLAIIADIEILSLSPRRLINAGIGDTIGKIIAVR
DWRLAAKLRGEYYGDYTASLALMSAKHAFQCTKIINKDIKYGVRMLIEALISSGVAMGMA
GSTRPASGSEHLFAHAVELLHPEGVLHGELVGLGTIIMAYLHGINWKIIRDRLKKIGFPV
KAKDLGLSDEEVIKALTIAHTIRPERYTILGDRGLTWSSAEKIARVTKIID
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaaagaacacgtaatcagtttacctagaagggttttcgtaggacatgacata
atatatgacatttctatttacttctcgcaactaggcataacttctccatttctaatagtc
acaggaacaaaatatactaagaaaatagcggatagagttatagaaaatcttccaaaaaat
gctaaatatgaggtaatcgaaatagatactgctactttagacgatgtatataaggtagag
gaggttgttaagaaggttaatcctaatatattgctaggaataggtggagggaaagttata
gacgttacgaaatacgcagcgtttaggaataacctagaattcgtcagtatacctacctct
ccatcacacgatggaatcacatcgccattcgcttcaataaaaggattacaaaagccagtt
tcggtaaaggcaaaagaaccattagcaattattgcagacatagaaattctaagcttgtcc
ccaagaagattaataaacgcaggaataggggatacaatagggaaaataatagcagtgaga
gattggaggttagcggctaagttaagaggagaatattatggcgattacacggcatcttta
gcgttaatgtcagcaaaacatgcatttcaatgcactaagataataaataaggacataaag
tacggtgtaagaatgctaatagaagcactaataagtagcggagtagcaatgggaatggct
ggaagcaccagaccagcaagtggctctgaacatctctttgcacatgcggttgagttatta
cacccagagggggtattgcatggtgaacttgttggtttaggaacaattattatggcctac
ttgcatggcataaattggaaaataataagagacagacttaaaaaaataggattcccagta
aaagccaaagacttaggtctttctgatgaagaagtaataaaagccttaaccatagctcat
actataagaccagagaggtacacaatcttaggggataggggtttaacttggagttctgca
gaaaaaatagcaagagtaacaaaaattatagattaa

DBGET integrated database retrieval system