KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1585Help
Entry
YG5714_1585       CDS       T00901                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_1585
   01230 Biosynthesis of amino acids
    YG5714_1585
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_1585
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     YG5714_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1448615..1449637
Genome map
AA seq 340 aa AA seqDB search
MISVAVNGYGTIGKRVADAILKQPDMRLVGVAKTSPNYEAFIAHRKGIKIYVPQQSIKKF
EESGIPVAGTIEDLVKASDIVVDTTPNGVGAQYKPIYQQFQRNAIFQGGEKAEVADISFS
ALCNYDEALGKKYIRVVSCNTTALLRTICTINKVTKVEKVRATIVRRAADQKEVKKGPIN
SLVPDPATVPSHHAKDVNSVIKNLDIVTMAVIAPTTLMHMHFINITLKDKVEKKDVLSVL
ENTPRIVLISSKYDAEATAELVEVARDLKRERNDIPEVMVFDDSVYVKDNEVMLMYAVHQ
ESIVVPENVDAIRASTRLMSAEDSIRITNESLGILKGYLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtgtagctgttaatggatatggtactataggtaagagagttgctgatgctatc
cttaaacaaccagatatgagactagtaggggttgcaaagacatctccaaattacgaagcg
tttatagcacatcgtaaggggataaagatttacgtcccacaacaatctattaagaaattc
gaagaatctggaataccagttgctggcacaatagaggacctagtaaaagcctctgatatt
gtagtagatactacgcccaatggtgttggtgcacaatataagccaatttaccaacaattc
caaagaaacgctatattccaaggtggagaaaaagcggaagttgctgatatttcgttctca
gccttatgcaattacgatgaggcccttggcaaaaagtacattagagtcgtgtcatgtaat
actacagcactactaagaacaatatgcacaataaataaggtcactaaagttgaaaaagtt
agggcaacaatagttagaagagctgcagatcaaaaggaagttaagaaaggtcctataaat
tcattagtaccagaccctgcaactgtaccaagtcatcatgcaaaagacgttaacagtgtc
attaaaaatttagatatagttacaatggcagtaatagctccaacaacgttaatgcatatg
cactttattaacataaccttaaaggataaggtagagaaaaaagatgtacttagcgttctg
gagaacactcctaggatagtcctaatctcctcaaagtatgatgcagaagctacagcagaa
ttagtagaagtagcaagagatctgaaaagggaaagaaatgatattccagaggtgatggtg
ttcgatgactctgtttatgttaaggataacgaggttatgttaatgtatgcagtgcatcaa
gaatcaatagtggtaccagaaaatgtggatgcaataagggcctccactagattaatgagt
gcagaagactcaataagaattacaaatgaaagtttaggaatattaaaggggtacctaata
tga

DBGET integrated database retrieval system