KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1705Help
Entry
YG5714_1705       CDS       T00901                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:siy01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:siy00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:siy00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1547180..1548205)
Genome map
AA seq 341 aa AA seqDB search
MVKEVCMKCRKERESIYEIKCNKCGGPFEILIDFEFDKNPERGFPYSEKIFPYIKHFISL
GEGRTPLIKKGNIWFKLDFLNPSGSYKDRGAVTLVSYLAEKGVKQISEDSSGNAGSAIAA
YSAAAGIEAYIFVPETAKGGKLKQIESYGAHVVRVRGSREDVAKAAENSGYYYASHVLQP
QFRDGIRTLAYEIVKDLDWKIPNYVFIPVSAGTLLLGVYKGFKHLLDSGVISEMPKIVAV
QTEQVMPLCAKFKKISYTPPDKVTSIADALVSTRPFLLDYMVKASSECIVVSDNEIVEAW
KELAKMGLLVEYSSATVFAAYKKYSVNDAVLVLTGSGLKVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaggtttgtatgaaatgcagaaaggaaagggaaagtatatacgagattaag
tgtaacaaatgcggaggaccattcgagatcctgatagattttgaatttgataagaatcct
gagagaggttttccctatagtgaaaagattttcccttacatcaaacatttcatatcccta
ggagagggaagaactccattaattaaaaaggggaacatatggtttaaactcgacttctta
aatccatcaggatcatacaaggatagaggagcagtgactctggtctcttatcttgcggaa
aaaggtgtaaaacaaattagtgaagactcttctggaaatgcaggatcagcaatagctgcg
tattctgcagctgctggtattgaggcatacattttcgttcctgaaacggcaaaaggagga
aaacttaagcaaatagaatcctacggtgctcacgttgttagagtaagggggagtagagaa
gatgtagcaaaagctgcagagaattctggttactattacgcatcacatgttttacaacct
caatttagagatgggattagaactctggcatatgaaattgtaaaggatttagattggaaa
attcctaattatgttttcattccagtatcagcaggaactttacttttaggtgtttataag
gggttcaagcacttgctagattctggtgtcatatcggaaatgcctaaaatcgtagcagtc
caaacagagcaagttatgccactttgtgctaaattcaaaaagatttcttacacaccacca
gacaaggttacctccattgcagacgctttagtatcaactagaccatttctactagattat
atggtaaaggcttctagtgaatgcatagttgtaagcgataatgaaatagtagaagcttgg
aaagaattggctaaaatgggactgctggtagaatatagttctgctactgtatttgctgct
tataagaaatacagtgttaacgatgcagtattagttttaaccggtagcggattaaaggta
ttatga

DBGET integrated database retrieval system