KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_1705Help
Entry
YG5714_1705       CDS       T00901                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YG5714_1705
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YG5714_1705
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YG5714_1705
Enzymes [BR:siy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YG5714_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1547180..1548205)
Genome map
AA seq 341 aa AA seqDB search
MVKEVCMKCRKERESIYEIKCNKCGGPFEILIDFEFDKNPERGFPYSEKIFPYIKHFISL
GEGRTPLIKKGNIWFKLDFLNPSGSYKDRGAVTLVSYLAEKGVKQISEDSSGNAGSAIAA
YSAAAGIEAYIFVPETAKGGKLKQIESYGAHVVRVRGSREDVAKAAENSGYYYASHVLQP
QFRDGIRTLAYEIVKDLDWKIPNYVFIPVSAGTLLLGVYKGFKHLLDSGVISEMPKIVAV
QTEQVMPLCAKFKKISYTPPDKVTSIADALVSTRPFLLDYMVKASSECIVVSDNEIVEAW
KELAKMGLLVEYSSATVFAAYKKYSVNDAVLVLTGSGLKVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaggtttgtatgaaatgcagaaaggaaagggaaagtatatacgagattaag
tgtaacaaatgcggaggaccattcgagatcctgatagattttgaatttgataagaatcct
gagagaggttttccctatagtgaaaagattttcccttacatcaaacatttcatatcccta
ggagagggaagaactccattaattaaaaaggggaacatatggtttaaactcgacttctta
aatccatcaggatcatacaaggatagaggagcagtgactctggtctcttatcttgcggaa
aaaggtgtaaaacaaattagtgaagactcttctggaaatgcaggatcagcaatagctgcg
tattctgcagctgctggtattgaggcatacattttcgttcctgaaacggcaaaaggagga
aaacttaagcaaatagaatcctacggtgctcacgttgttagagtaagggggagtagagaa
gatgtagcaaaagctgcagagaattctggttactattacgcatcacatgttttacaacct
caatttagagatgggattagaactctggcatatgaaattgtaaaggatttagattggaaa
attcctaattatgttttcattccagtatcagcaggaactttacttttaggtgtttataag
gggttcaagcacttgctagattctggtgtcatatcggaaatgcctaaaatcgtagcagtc
caaacagagcaagttatgccactttgtgctaaattcaaaaagatttcttacacaccacca
gacaaggttacctccattgcagacgctttagtatcaactagaccatttctactagattat
atggtaaaggcttctagtgaatgcatagttgtaagcgataatgaaatagtagaagcttgg
aaagaattggctaaaatgggactgctggtagaatatagttctgctactgtatttgctgct
tataagaaatacagtgttaacgatgcagtattagttttaaccggtagcggattaaaggta
ttatga

DBGET integrated database retrieval system