KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2049Help
Entry
YG5714_2049       CDS       T00901                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_2049
   00030 Pentose phosphate pathway
    YG5714_2049
   00051 Fructose and mannose metabolism
    YG5714_2049
   00052 Galactose metabolism
    YG5714_2049
   00500 Starch and sucrose metabolism
    YG5714_2049
   00520 Amino sugar and nucleotide sugar metabolism
    YG5714_2049
  Nucleotide metabolism
   00230 Purine metabolism
    YG5714_2049
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YG5714_2049
Enzymes [BR:siy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     YG5714_2049
    5.4.2.8  phosphomannomutase
     YG5714_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1838599..1839966
Genome map
AA seq 455 aa AA seqDB search
MGKLFGTDGIRGVTNTELQPEFALKLGKAIGTYFGKGARILIGRDVRAGGDMLLKAVESG
LLSSGVLVYEAGMAPTPAFQYGVKTLGYDGGIIITASHNPAEYNGIKVLSPHGIEIARED
EDKIEDIYFNNKFHVVEWNGLVNDVKREDKVIETYVQGILSHVDADKIRSKKYKVLIDPA
NSVGTLATPIVARELGCKVFTINGNLDPLFSARTPEPTFESLSETAKVAKQLGVDLAVAH
DGDADRAIFIDSMGRVQWGDRSGTLLSYWASIKAPNLPKRIFTAVSSSSLVEEYLKQYNI
EVKWTKVGSVDIAHTLFKEKGVAGFEENGGFMYPPHQAVRDGAMSFALMLEMMASENENS
TELFNRLPVYYLVKTKVRITEKSNINKIYDEIIDKYGKYGNIVTIDGVKIISNDFWLLVR
KSGTEPIIRILVEAKDENKSKELAKELEKLVSELA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttatttgggacggatggaataagaggagttactaatactgaattgcaacca
gaatttgcgttaaaattaggaaaagctataggaacatatttcggtaaaggtgctagaatt
ctaataggcagggatgtaagagctggaggagatatgttacttaaagccgttgagagtgga
ttgttaagtagtggcgtattggtctatgaagctgggatggctcctactccagctttccag
tacggtgtgaaaactttaggatatgacggtggtattataataaccgctagtcataatcca
gctgaatataatggtatcaaagtcctttctccacatggtattgagatagctagggaagac
gaggataaaatagaagatatatactttaataataaatttcatgtagtagaatggaatggt
ttagtaaatgatgtaaaaagagaagataaagttattgaaacttacgtgcaagggatactc
tctcatgttgatgctgataaaattaggagtaaaaagtataaggttctcatagaccctgct
aatagtgtaggtacattggcaacaccaattgttgcgagggagttgggatgtaaagttttt
actatcaatgggaatttagatcctctattttcagctagaacaccagaacccacatttgag
agtcttagtgagactgcaaaagttgctaaacaactaggcgtggatttggcagtagctcat
gatggtgacgcggatagggcaattttcatagactccatggggagagttcaatggggtgat
agaagcggtactttattgtcatattgggcttcgataaaagctccaaatctacctaagcgt
atatttactgcagtttctagctctagcttagttgaagaatatctaaaacagtacaatata
gaggttaagtggactaaggtaggtagtgtagacattgcacatacgctatttaaggaaaaa
ggagtagcgggatttgaggaaaatggtggatttatgtatcctcctcatcaagcagtaaga
gacggtgcaatgtcattcgctttaatgctggaaatgatggcatctgagaatgaaaactct
actgaactatttaatagactccccgtttattatttagtgaaaacaaaagtaagaattacg
gaaaagagtaatataaataagatttatgacgaaataatagataagtacggaaagtacggg
aatatagttacaatagatggtgttaagattattagcaacgatttctggctcctagttagg
aagagtggtacagagccaataataagaatattagtcgaggcaaaagatgagaataaatca
aaagaattagctaaagagttagaaaagttggtgagtgagttagcgtga

DBGET integrated database retrieval system