KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2268Help
Entry
YG5714_2268       CDS       T00901                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YG5714_2268
   00052 Galactose metabolism
    YG5714_2268
   00500 Starch and sucrose metabolism
    YG5714_2268
   00520 Amino sugar and nucleotide sugar metabolism
    YG5714_2268
Enzymes [BR:siy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YG5714_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2030141..2030902
Genome map
AA seq 253 aa AA seqDB search
MLKKAVITSAGKGSRMKHITSVLPKALLPLFVTENGGKVTRPVIDLIMDSLNKVGIEKFC
IVVGRNGMLLMQYLFDRTPTFVFQDMPKGFGDAVLRAEDFSSNEPFFVHADDGVLTKGYD
SLKLLFDEVSPDAVLFVRRVENPSRYGVVTIQDKGVYDGHKLYKVIDAEEKPLHPKSNLA
IAAVYIFKPSIFSALKQINVEEGKEIELTYGIHNLLLDGKEVYALEMNEDEKWLNVGDPK
SYLDALNYSFKFL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaaaagccgtaatcacatctgctggaaaaggtagtaggatgaaacatataacg
agtgtattacccaaggcattacttcctttattcgtcaccgaaaacggaggtaaggtaact
agaccagttatagatttaataatggattcattgaacaaggtaggtattgaaaaattttgt
attgtagtaggaagaaacggaatgttactaatgcaatacttattcgatagaacaccaacc
tttgtattccaagatatgcctaagggatttggtgacgctgtattaagagcagaggacttc
tcatccaatgagccatttttcgttcatgcagacgatggcgttctaactaaaggatacgat
tcgcttaaattgctatttgatgaagtaagtccagatgctgtacttttcgtgagaagagtt
gaaaatcctagtagatacggtgtggtaactatccaagataaaggggtatatgatggtcat
aaattatataaggtaattgacgccgaagaaaagccattacatccaaaatctaatttagct
atagcagcggtttatatttttaagcctagtatatttagtgcgttgaaacaaattaatgtt
gaagaaggtaaagagatagaattgacttatggaatacataacttgttgctagatggtaaa
gaagtttatgcgttagaaatgaatgaagatgaaaaatggttgaatgtgggagatcctaaa
agctatcttgacgcattaaactattcatttaaatttctttaa

DBGET integrated database retrieval system