KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2351Help
Entry
YG5714_2351       CDS       T00901                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K03885  
NADH dehydrogenase [EC:1.6.99.3]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    YG5714_2351
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With other acceptors
    1.6.99.3  NADH dehydrogenase
     YG5714_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2103303..2104325
Genome map
AA seq 340 aa AA seqDB search
MQTERVVILGGGFAGIAAKLVYPNAILVDEKDFMVVTPRLVEVIEKSLPLSHALIPRKVD
VKAKVLKIDFKEKKVITSDGEIRFDKLIIALGYEQDLSKIKGAEKYGIGFTLENVEKIKS
FREGSIVTILGGGALGVELAGALRKRGYTVNLVEAENRLVPYLIPDFSNEVQKVLEKQGV
NVILRAKVEEVKENEVITTQGRIRSDYIIFSAGFSGPKIINEIGLSNRNNRMLVYRFLRS
VDYDFVYGAGDCANFKDGFIPQSAQVSLQAGEVAMNNAIKDEKVEFKPVQKAIVFKIGED
YIGLLKHTVISGPIASLIKSFAISSLEGKVKKLNRFILAM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgaaagagtagtaatattaggaggaggatttgctggaattgcagctaagttg
gtatatcctaatgcaatacttgttgacgaaaaggatttcatggtggttactccaaggtta
gtagaggttatagagaaaagcctccctttatctcacgctttaattcctaggaaagttgac
gttaaggctaaggttttaaagattgactttaaggagaagaaagtaataacgagtgatggt
gaaattaggttcgataagctaataattgcgttgggttatgagcaagatttaagtaagata
aagggagctgaaaagtacggtataggatttaccttggaaaatgtagaaaagatcaagtca
tttagagaaggttcgatagttacgattcttggaggaggagcacttggcgttgagttagct
ggagcgttaaggaagaggggctatactgtaaatttggttgaggcagaaaatagattagta
ccctatctgataccagatttctctaatgaggttcaaaaggttttggaaaagcaaggcgtt
aacgtaattttaagggctaaggtagaggaagtaaaggaaaatgaggtaattaccacgcaa
ggaagaataaggagtgattatataatattctctgcgggtttttccggccccaaaataata
aatgaaatcggattatcaaataggaacaataggatgttagtttacagattcctcagatca
gtagattatgatttcgtttatggcgctggtgattgcgctaactttaaggatgggttcata
ccacaatcagcacaagtttccttacaggctggtgaggttgctatgaataatgcaataaaa
gatgagaaagtcgagtttaaaccagtacagaaggctatagtatttaagattggtgaagac
tatattggtttgctaaagcacaccgtaataagcggtcccatagcgtcactcattaaatcc
tttgctatcagttctttagaaggtaaggttaagaaactgaatagatttattctagctatg
tga

DBGET integrated database retrieval system