KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2728Help
Entry
YG5714_2728       CDS       T00901                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
siy00010  Glycolysis / Gluconeogenesis
siy00020  Citrate cycle (TCA cycle)
siy00620  Pyruvate metabolism
siy00640  Propanoate metabolism
siy00650  Butanoate metabolism
siy00680  Methane metabolism
siy00720  Carbon fixation pathways in prokaryotes
siy01100  Metabolic pathways
siy01120  Microbial metabolism in diverse environments
siy01130  Biosynthesis of antibiotics
siy01200  Carbon metabolism
Module
siy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_2728
   00020 Citrate cycle (TCA cycle)
    YG5714_2728
   00620 Pyruvate metabolism
    YG5714_2728
   00640 Propanoate metabolism
    YG5714_2728
   00650 Butanoate metabolism
    YG5714_2728
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YG5714_2728
   00680 Methane metabolism
    YG5714_2728
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    YG5714_2728
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     YG5714_2728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ACP46951
JGI: SislY12728
UniProt: C3NBR6
Position
2468742..2469296
Genome map
AA seq 184 aa AA seqDB search
MLEIRFHGRGGQGVVTASQLLAEAAGYENLYTSSFPIYGAERRGAEIEAYCRISENPIRV
TSPVEEPDYLVVIDNSLLQISRNLFRGLKDTSTIILNSPSKPDLNWRTFHVNATKIATDL
GLVKSGWPMVNVIILGALIRVMGIPKLSSLEQAIEEEFGGKIAELNIKGARLAYEQVGVE
YVTA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgaaataagattccacggtagaggtggacaaggtgttgtaacggcttctcaacta
ttagctgaagcagctggatatgaaaacctttacacttcttcttttcccatttatggagcg
gaaaggagaggtgcagaaatagaggcatattgtagaatatccgagaacccgattagggtt
acttccccagtagaagaaccagattacttggtcgtaatagataattcccttctccaaata
tctaggaatttgttcagaggactaaaagatacttcgacgataatattaaattcaccttcc
aaaccggatcttaactggagaacttttcacgttaatgcaactaaaattgcaacagatcta
ggcctagtaaagtcagggtggccgatggtgaacgtaatcatcttaggagcgttaataagg
gtaatgggaatacctaaattatcttcacttgagcaagcaatagaagaggaatttggaggc
aaaatagctgaactcaacataaaaggtgcaagattggcctatgaacaagttggtgttgag
tatgtcactgcttga

DBGET integrated database retrieval system