KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2729Help
Entry
YG5714_2729       CDS       T00901                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
siy00010  Glycolysis / Gluconeogenesis
siy00020  Citrate cycle (TCA cycle)
siy00620  Pyruvate metabolism
siy00640  Propanoate metabolism
siy00650  Butanoate metabolism
siy00680  Methane metabolism
siy00720  Carbon fixation pathways in prokaryotes
siy01100  Metabolic pathways
siy01120  Microbial metabolism in diverse environments
siy01130  Biosynthesis of antibiotics
siy01200  Carbon metabolism
Module
siy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_2729
   00020 Citrate cycle (TCA cycle)
    YG5714_2729
   00620 Pyruvate metabolism
    YG5714_2729
   00640 Propanoate metabolism
    YG5714_2729
   00650 Butanoate metabolism
    YG5714_2729
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    YG5714_2729
   00680 Methane metabolism
    YG5714_2729
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    YG5714_2729
Enzymes [BR:siy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     YG5714_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_4 Fer4_13 Fer4_17 Fer4_15 Fer4_22 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ACP46952
JGI: SislY12729
UniProt: C3NBR7
Position
2469262..2469546
Genome map
AA seq 94 aa AA seqDB search
MNKLVLSMSLLEYQYFPVTRPNKGAGGRTGAWRIVKPVVDYNKCIGCKVCFMFCPESTIV
PSNGKVRVDYEYCKGCGVCANVCPVKAISMVNEQ
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttggtgttgagtatgtcactgcttgaatatcaatactttcctgtaactaga
cccaataagggtgctggaggaagaactggagcatggagaatagtaaaacctgttgttgat
tataacaagtgcataggctgtaaagtgtgttttatgttttgcccagaatccacaatagtc
cctagcaatggtaaggtaagagtggattatgagtattgcaaaggctgtggagtttgtgcc
aatgtatgcccagttaaggctataagtatggtgaatgagcaatga

DBGET integrated database retrieval system