KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2758Help
Entry
YG5714_2758       CDS       T00901                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:siy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2496080..2496997
Genome map
AA seq 305 aa AA seqDB search
MRQIDALKSPRFTQISTFGRLPICGRDEEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGS
RLLRPYNQFLDTYPFDKLNACDMGDINIIPGYIEDTMNIIQTNLYEIISSKNLVPFIAGG
DHSITLPVLRALHKKYGKINIIHLDSHYDFWDSYWGKKHTHGTWLRRAIEEGLIKEAIQG
GIRASTFSKEDLKDKERLGVKSFTIRDLKYNLDSVIREINSLSGPTHVSIDIDVVDPAFA
PGTGTPEVGGLTSFEIIEIIRKLRFDKLVGFDVVEVAPPYDVSEITTMLAANIIYEGMSV
LSLNL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaatagacgcgttaaaatctccacgcttcacacaaatttctaccttcggtaga
ttaccaatttgcggaagagatgaggaaataaaggcggcgtttttaggaatacctttcgat
gatgctgtaacttatagaccgggagccagatttggaccaatgggaataagacaaggatct
agattattaagaccttacaatcaattcctagatacttatccttttgataagcttaacgct
tgtgatatgggtgatataaacattattccggggtacattgaggatacaatgaacataata
caaacgaatctttacgaaataatatcatcaaaaaacctagtgccctttatagctggtgga
gatcactcaatcacgttacccgttttaagggctttacataagaagtatggaaaaataaat
atcatacacttggattcacattacgacttctgggattcctattggggtaagaaacatacg
catggtacgtggttgaggagggcaattgaagagggcttaatcaaagaagctatacaagga
ggaattagggcctcaacgttctcgaaagaagatcttaaagataaggagaggttaggagtg
aagagtttcacaattagagatttaaagtataatttagattctgttataagggaaataaat
tccctatctggtcccacacacgtttccattgatatagatgttgtagatccggcgtttgcc
cctgggactggtacgccagaagtgggtggtttgacaagcttcgaaattatagaaattatc
agaaagctgagatttgataaactagttggatttgatgttgtagaagttgccccaccatat
gatgtaagcgaaatcaccacaatgttagctgcgaatatcatctatgaaggaatgagcgta
ctctcactaaatctttaa

DBGET integrated database retrieval system