KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2892Help
Entry
YG5714_2892       CDS       T00901                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Brite
Enzymes [BR:siy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     YG5714_2892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2620581..2621291)
Genome map
AA seq 236 aa AA seqDB search
MGAKEDLLRSIKNSKLANAFIKVNREDFLPQLLKKYAYDPNYIDKPFYVTPNITTTALSL
GIYILDILNLEENQKVLEIGTGIGYYTALIAEVVGENNIVSIEIDDTMFEYAKNVLLIRY
PLIKLLKTDGSLGYEKEAPYDRIVVWAAAPTIPCKLYDQLKENGIMVVPIGGKKAQGLYR
ITKTGYEPKIERIGDVIFMKMRGLFGFYDNDDPNERRIKKLEEKVNRLLSKFMNQN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaaaagaagacttattaagatctataaaaaattcaaagttggctaatgcattt
atcaaagttaatagagaagactttttgccgcaactattgaaaaaatacgcatatgaccca
aattatatagataaacccttttatgtaacacctaacattacgacaacggcgctaagttta
ggcatatatattcttgatattcttaatttagaagaaaatcagaaggttttagagataggt
actggtataggttattacacagcactgatagctgaagtagttggtgagaataacattgta
tctatcgaaatcgatgatacgatgtttgagtacgctaaaaatgttcttctgatcagatac
cccctaattaaattactgaagacggatggaagtttaggatatgagaaagaggccccttat
gatcggatcgtagtatgggcagctgcaccaactataccttgtaagctatacgatcaactt
aaggaaaacgggatcatggtagtaccaataggaggtaaaaaagcccaaggtctttataga
attactaaaactggttatgagcctaagatagaaagaattggggatgtgatatttatgaaa
atgagaggattatttggattttatgataatgacgatccaaacgagaggagaataaaaaaa
ttagaggaaaaggtaaataggttgctgtcaaaattcatgaatcaaaattag

DBGET integrated database retrieval system