KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2898Help
Entry
YG5714_2898       CDS       T00901                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YG5714_2898
   01230 Biosynthesis of amino acids
    YG5714_2898
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_2898
   00051 Fructose and mannose metabolism
    YG5714_2898
   00562 Inositol phosphate metabolism
    YG5714_2898
Enzymes [BR:siy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YG5714_2898
Exosome [BR:siy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YG5714_2898
  Exosomal proteins of bladder cancer cells
   YG5714_2898
  Exosomal proteins of melanoma cells
   YG5714_2898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2625257..2625940)
Genome map
AA seq 227 aa AA seqDB search
MKPPIIVINFKAYENSFGNKAIELGKKIEKISKEHSVEIILSVPATMIYRMVQEVDLPIY
AEHVDPVPLGAYTGAVLPEMIKDADAKGTLINHSERRLRADEIDDVLKRTRKLGLSSILC
VDRYELVYPFSLLRPDAILIEPPELIGTGISVSKAKPEVITKAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALKAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccccctattattgtaataaactttaaggcctacgaaaactcctttggtaataag
gcaattgagttaggtaaaaagatagaaaaaataagtaaggagcattcagttgaaataata
ttgtcagtaccagctactatgatctacagaatggtccaagaggtagatttaccaatttat
gctgaacatgtagatccagttcctctaggcgcttatacgggagccgtattaccagaaatg
ataaaagatgcagatgctaaagggacattgataaatcacagtgagagacgtctaagggct
gatgaaatagatgatgtattaaaaagaactaggaaattaggtttgagtagtatactatgc
gttgacagatatgagttagtctatccctttagtttactaaggcctgatgcaattttgata
gagcctccagaattgataggaaccggtatctcagtgtctaaagccaaacccgaggtaata
acaaaagccgtggatgagataagaaagtctgaggggatctatttaatagcgggtgctgga
attacaaccggtgaggacgtttataaagcgttaaagctcggagctcatggaataggtgta
gcaagtgcagtcatgaaggctaaagaacctgagaaagttgttgaagattttatcacaagt
gcattgaaggctatctcttcttag

DBGET integrated database retrieval system