KEGG   Sulfolobus islandicus Y.G.57.14: YG5714_2898Help
Entry
YG5714_2898       CDS       T00901                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
siy  Sulfolobus islandicus Y.G.57.14
Pathway
siy00010  Glycolysis / Gluconeogenesis
siy00051  Fructose and mannose metabolism
siy00562  Inositol phosphate metabolism
siy01100  Metabolic pathways
siy01110  Biosynthesis of secondary metabolites
siy01120  Microbial metabolism in diverse environments
siy01130  Biosynthesis of antibiotics
siy01200  Carbon metabolism
siy01230  Biosynthesis of amino acids
Module
siy_M00002  Glycolysis, core module involving three-carbon compounds
siy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:siy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YG5714_2898
   00051 Fructose and mannose metabolism
    YG5714_2898
   00562 Inositol phosphate metabolism
    YG5714_2898
Enzymes [BR:siy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YG5714_2898
Exosome [BR:siy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YG5714_2898
  Exosomal proteins of bladder cancer cells
   YG5714_2898
  Exosomal proteins of melanoma cells
   YG5714_2898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO ThiG FMN_dh His_biosynth DUF561 G3P_antiterm IGPS DHO_dh Glu_synthase IMPDH Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACP47118
JGI: SislY12898
UniProt: C3NCL2
Position
complement(2625257..2625940)
Genome map
AA seq 227 aa AA seqDB search
MKPPIIVINFKAYENSFGNKAIELGKKIEKISKEHSVEIILSVPATMIYRMVQEVDLPIY
AEHVDPVPLGAYTGAVLPEMIKDADAKGTLINHSERRLRADEIDDVLKRTRKLGLSSILC
VDRYELVYPFSLLRPDAILIEPPELIGTGISVSKAKPEVITKAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALKAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccccctattattgtaataaactttaaggcctacgaaaactcctttggtaataag
gcaattgagttaggtaaaaagatagaaaaaataagtaaggagcattcagttgaaataata
ttgtcagtaccagctactatgatctacagaatggtccaagaggtagatttaccaatttat
gctgaacatgtagatccagttcctctaggcgcttatacgggagccgtattaccagaaatg
ataaaagatgcagatgctaaagggacattgataaatcacagtgagagacgtctaagggct
gatgaaatagatgatgtattaaaaagaactaggaaattaggtttgagtagtatactatgc
gttgacagatatgagttagtctatccctttagtttactaaggcctgatgcaattttgata
gagcctccagaattgataggaaccggtatctcagtgtctaaagccaaacccgaggtaata
acaaaagccgtggatgagataagaaagtctgaggggatctatttaatagcgggtgctgga
attacaaccggtgaggacgtttataaagcgttaaagctcggagctcatggaataggtgta
gcaagtgcagtcatgaaggctaaagaacctgagaaagttgttgaagattttatcacaagt
gcattgaaggctatctcttcttag

DBGET integrated database retrieval system