KEGG   Streptococcus pneumoniae JJA: SPJ_0275Help
Entry
SPJ_0275          CDS       T00873                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sjj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244042..245421
Genome map
AA seq 459 aa AA seqDB search
MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYYNGIGSDKTSTFYENW
ERDIELLLETGHTVFRTSIQWSRIFPQGCGKVNPQGVDFYRKVFEAIKAKGIRLLVNLYH
FDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWITFNEPIVPVEFGYFYDAH
YPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLNLTPAYPRSQHPADVKAAR
IAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEELELIRDNTVDFLGVNYYQPL
RVMAPRFAKHPDSPLLPEHFYEPYVMPGRKINSHRGWEIYEQGIYDIAQNIKENYGNIEW
MLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHRAIEDGANCKGYLIWTFIDCWS
WLNSYKNRYGLVELDLETQERRLKKSGHWFKELSDNNGF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatttccaaaggattttgtctggggatcctctacttctggaccgcagacagaa
ggacgtgtagctggtgacggtaagggagacaatctctgggattactggttccaagtggag
ccaaatcgttactataatgggattggttcagataagacatcgactttttatgaaaattgg
gagcgggatattgagcttttgttagagactggtcacacagtctttcggacttctattcag
tggtcacggatttttccacaaggctgtggaaaagtcaaccctcaaggtgtggatttttat
cgtaaggtctttgaggctattaaggctaaaggaattcgtctgttagtcaatctctatcat
tttgatttaccttttgcccttcaagaggatggtgatggttgggaaaataaggcgacagtc
tcagcctatgaagactatgctcgtttttgttttgagacttatggagatttagtggatcaa
tggattacctttaacgagcccatcgttcctgtagaatttggttatttttatgatgcccat
tatccacataaggtggatgcagaggcagctgttaaggtagcctatcatacacaattggcc
agcagccgggctgttaaggcttgccatgaacttttgcctgattccaagattgggattgtc
ctcaacttgacaccggcttatccacgtagccagcatcctgctgatgtcaaggcagctcgt
attgcggccctttttcaggcccaatctttcttagatccatctgtcttggggacttatcca
caggagttggtagaaatcttgcatgaacacggtcttttacctgatgctacagaggaagag
ttggaactcattcgtgataatacggtggacttccttggtgtgaactactatcaacctttg
cgtgttatggctcctcgatttgctaagcatccagatagtccactcttaccagaacatttt
tacgagccttatgtgatgcctggacgtaaaatcaattctcaccgtggttgggagatttat
gagcaagggatttatgacatcgcccaaaatatcaaggaaaattatggcaatattgagtgg
atgttgactgagaatggtatgggtgttgaaggggaagaaaaattccgtcaagatggaatg
attcaagatgattaccgtattgactttgtaaaaggtcatcttcgtgaacttcaccgtgcc
attgaagatggtgccaactgtaagggctacttgatttggacctttattgactgctggtca
tggctcaacagctataaaaatcgctatggtttggtcgaattagacttggaaacgcaagaa
cgtcgtctgaagaaatcaggccactggttcaaagaattaagcgataataatggattttaa

DBGET integrated database retrieval system