KEGG   Streptococcus pneumoniae JJA: SPJ_0309Help
Entry
SPJ_0309          CDS       T00873                                 

Definition
(GenBank) peroxiredoxin Hyr1 (hydrogen peroxide resistanceprotein 1) (oxidant receptor peroxidase 1) (glutathione peroxidase 3)(phospholipid hydroperoxide glutathione peroxidase 3) (phgpx3)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
sjj00480  Glutathione metabolism
sjj00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sjj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPJ_0309
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPJ_0309
Enzymes [BR:sjj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPJ_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA DUF4174 Redoxin
Motif
Other DBs
NCBI-ProteinID: ACO19939
UniProt: C1CC90
Position
complement(283854..284330)
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQAQGFEIL
DFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDQKSGPLGK
RIEWNFSKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactttatgatttttccgttttgaaccaaaacaaccaagcaactcccttggat
agctatcgtggcaaagttctcttgattgtcaacactgctactggatgtggtttaacgccc
cagtaccagggacttcaagaactctatgaacgctatcaagctcagggcttcgaaatattg
gatttcccttgcaatcagtttatgggacaagcacccggcagcgcagaggaaatcaacgcc
ttctgtagcctacattttcaaaccaccttcccacgttttgccaagattaaggtcaacggt
aaggaagcagaccctctctatgtctggttaaaagaccagaaatccggcccactaggaaaa
cgaatcgaatggaatttctctaagtttctcatcggtcgagatgggcaagtctttgaacgc
ttttcttcaaaaacagacccaaaacaaattgaagaggcgatacaaactctactataa

DBGET integrated database retrieval system