KEGG   Streptococcus pneumoniae JJA: SPJ_0596Help
Entry
SPJ_0596          CDS       T00873                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sjj00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sjj00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sjj00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576049..582750
Genome map
AA seq 2233 aa AA seqDB search
MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYADETLITHTAEKPKEE
KMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTPKEEKVSAKPEEKAPRI
ESQASSQEKPLKEDAKAVTNEEMNQMIEDRKVDFNQNWHFKLNANSKEAIKPDADVSTWK
KLDLPYDWSIFNNFDHESPAQNEGGQLNGGEAWYRKTFKLDEKDLKKNVRLTFDGVYMDS
QVYVNGQLVGHYPNGYNQFSYDITKYLHKDGRENVIAVHAVNKQPSSRWYSGSGIYRDVT
LQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNTDDKDHELVAEYQIVERGGHA
VTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKPALYELITRVYRDGQLVDAKKD
LFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGAEENYKAEYRRLKQMKEMGVNSI
RTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPYDYGRFFEKDATHPEARKGEKWSD
FDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLATVKRLVKVIKDVDKTRYVTMGADK
FRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAKHPKWLIYGSETSSATRTRGSYYRPE
RELKHSNGPERNYEQSDYGNDRVGWGKTATASWTFDRDNAGYAGQFIWTGTDYIGEPTPW
HNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQWVSVKKKPMVHLLPHWNWENKELASKVA
DSEGKIPVRAYSNASSVELFLNGKSLGLKTFNKKQTSDGRTYQEGANANELYLEWKVAYQ
PGTLEAIARDESGKEIARDKITTAGKPAAVRLIKEDHAIAADGKDLTYIYYEIVDSQGNV
VPTANNLVRFQLHGQGQLVGVDNGEQASRERYKAQADGSWIRKAFNGKGVAIVKSTEQAG
KFTLTAHSDLLKSSQVTVFTGKKEGQEKTVLGTEVPKVQTIIGEAPEMPTTVPFLYSDGS
RAERPVTWSSVDVSKPGIVTVKGMADGREVEARVEVIALKSELPVVKRIAPNTDLNSVDK
SVSYVLTDGSVQEYEVDSWEITEVDKAKLSVAGSRIQMTGQLAGETIHATLVVEEGNAAA
PVVPTVTVGGEAVTGLTSRQPMQYRTLSYGAQLPEVTASAENADVTVLQASAANGMRASI
FVQPKDGGPLQTYAIQFLEEAPKIAHLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLP
ADKVTFSTSGEGEVAIRKGMLELHKPGAVTLKAEYEGAKGQVELTIQANTEKKIAQSIRP
VNVVTDLHQKPTLPTTVTVEYDKGFPKAHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEA
RAKVSVEGIVSVEEVSVTTPIAEAPQLPESVRTYDSNGHVSSAKVAWDAIRPEQYAKEGV
FTVNGRLEGTQLTTKLHVRVSAQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKL
ISYNNQPANRWTNWNRTNPEASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIE
YYVGKTVPTAPKNPSFVGNEDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAV
RIRMVRADNKLGTSITEVQIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGK
VTAVTASVSNNGLATVVPSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAV
KQARLLQVGQALELPTKVPVYFTGKDGYETKNLTVEWEEVPAENLIKAGQFTVRGHVLGS
DLVAEVTVRVTDKLGEALSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRR
WTNWSPTPSSNPEVSAGVIFRENGKIVERTVAQAKLHFFADSGTDAPTKLVLERYVGPEF
EVPTYYSNYQAYDADHPFNNPENWEAVPYRADKDIAAGDEINVTFKAVKAKAMRWRMERK
ADKSGVAMIEMTFLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEE
NNQVASTVVDSGEDSLPVLVRLVSESGKQVKEYRIQLTKEKPVSEKTVAAVQEDLPKLEF
VEKDLAYKTVEKKDSTLYLGETRVEQEGKTGKERIFTAINPDGSKEEKLREVVEAPTDRI
VLVGTKPVAQEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSAASQAAVAAGLALLGL
SAGLVVTKGKKED
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggccattggaatcggaaaagagtttatagcattcgtaagtttgctgtggga
gcttgctcagtaatgattgggacttgtgcagttctattaggaggaaatatagctggagaa
tctgtagtttatgcggatgaaacacttattactcatactgctgagaaacctaaagaggaa
aaaatgatagtagaagaaaaggctgataaagctttggaaactaaaaatgtagttgaaagg
acagaacaaagtgaacctagttcaactgaggctattgcatctgagaagaaagaagatgaa
gccgtaactccaaaagaggaaaaagtgtctgctaaaccggaagaaaaagctccaaggata
gaatcacaagcttcaagtcaagaaaaaccgctcaaggaagatgctaaagctgtaacaaat
gaagaaatgaatcaaatgattgaagacaggaaagtggattttaatcaaaattggcacttt
aaactcaatgcaaattctaaggaagccattaaacctgatgcagacgtatctacgtggaaa
aaattagatttaccgtatgactggagtatctttaacaatttcgatcatgaatctcctgca
caaaatgaaggtggacaactcaacggtggggaagcttggtatcgcaagactttcaaacta
gatgaaaaagacctcaagaaaaatgttcgccttacttttgatggcgtctacatggattct
caagtttatgtcaatggtcagttagtggggcattatccaaatggttataaccagttctca
tatgatatcaccaaataccttcacaaagatggtcgtgagaatgtgattgctgtccatgca
gtcaacaaacagccaagtagccgttggtattcaggaagtggtatctatcgtgatgtgact
ttacaagtgacagataaggtgcatgttgagaaaaatgggacaactattttaacaccaaaa
cttgaagaacaacaacatggcaaggttgaaactcatgtgaccagcaaaatcgtcaatacg
gacgacaaagaccatgaacttgtagccgaatatcaaatcgttgaacgaggtggtcatgct
gtaacaggcttagttcgtacagcgagtcgtaccttaaaagcacatgaatcaacaagccta
gatgcgattttagaagttgaaagaccaaaactctggaccgttttaaatgacaaacctgcc
ttgtacgaattgattacgcgtgtttaccgtgacggtcaattggttgatgctaagaaggat
ttgtttggttaccgttactatcactggactccaaatgaaggtttctctttgaatggtgaa
cgtattaaattccatggagtatccttgcaccacgaccatggggcgcttggagcagaagaa
aactataaagcagaatatcgccgtctcaaacaaatgaaggagatgggagttaactctatc
cgtacaacccacaaccctgctagtgagcaaaccttgcaaatcgcagcagaactaggttta
ctcgttcaggaagaggcctttgatacgtggtatggtggcaagaaaccttatgactatgga
cgtttctttgaaaaagatgccactcacccagaagctcgaaaaggtgaaaaatggtctgat
tttgacctacgtaccatggtcgaaagaggcaaaaacaaccctgctatcttcatgtggtca
attggtaatgaaataggtgaagctaatggtgatgcccactctttagcaactgttaaacgt
ttggtcaaggttatcaaggatgttgataagactcgctatgttaccatgggagcagataaa
ttccgtttcggcaatggtagcggagggcatgagaaaattgctgatgaactcgatgctgtt
ggatttaactattctgaagataattacaaagcccttagagctaagcatccaaaatggttg
atttacggttcagaaacatcatcagcaacccgtacacgaggaagttactatcgccctgaa
cgtgaattgaaacatagcaatggacctgagcgtaattatgaacagtcagattatggaaat
gatcgtgtgggttgggggaaaacagcaaccgcttcatggacttttgaccgtgacaacgct
ggctatgctggacagtttatctggacaggtacggactatattggtgaacctacaccatgg
cacaaccaaaatcaaactcctgttaagagctcttactttggtatcgtagatacagccggc
attccaaaacatgacttctatctctaccaaagccaatgggtttctgttaagaagaaaccg
atggtacaccttcttcctcactggaactgggaaaacaaagaattagcatccaaagtagct
gactcagaaggtaagattccagttcgtgcttattcgaatgcttctagtgtagaattgttc
ttgaatggaaaatctcttggtcttaagactttcaataaaaaacaaaccagcgatgggcgg
acttaccaagaaggtgcaaatgctaatgaactttatcttgaatggaaagttgcctatcaa
ccaggtaccttggaagcaattgctcgtgatgaatctggcaaggaaattgctcgagataag
attacgactgctggtaagccagcggcagttcgtcttattaaggaagaccatgcgattgca
gcagatggaaaagacttgacttacatctactatgaaattgttgacagccaggggaatgtg
gttccaactgctaataatctggttcgcttccaattgcatggccaaggtcaactggtcggt
gtagataacggagaacaagccagccgtgaacgctataaggcgcaagcagatggttcttgg
attcgtaaagcatttaatggtaaaggtgttgccattgtcaaatcaactgaacaagcaggg
aaattcacccttactgctcactctgatctcttgaaatctagtcaagtcactgtctttact
ggtaagaaagaaggacaagaaaagactgttttggggacagaggtgccaaaagtacagacc
attattggagaggcacctgaaatgcctaccactgttccgtttctatacagtgatggtagt
cgtgcagaacgtcctgtaacctggtcttcagtagatgtgagcaagcctggtattgtaacg
gtgaaaggtatggctgacggacgagaagtagaagctcgtgtagaagtgattgctcttaaa
tcagagctaccagttgtgaaacgtattgctccaaatactgacttgaattctgtagacaaa
tctgtttcctatgttttgactgatggaagtgtacaagagtacgaagtagatagctgggag
attacggaagtagataaagccaaactttcagtagctggatcacgtattcaaatgactggt
cagttagctggagaaactattcatgcaacccttgtggtagaagaaggaaatgctgcagca
cctgtagtgccaactgttactgttggaggtgaagcagtaacaggtcttactagtcgacaa
ccaatgcaatatcgtactctatcttatggtgcccaattgccagaagtcacagcaagtgct
gaaaatgctgatgtgacagttcttcaagcaagcgcagcaaacggcatgcgtgcaagcata
tttgttcagcctaaagatggtggccctcttcaaacctatgcaattcaattcctagaagaa
gcaccaaaaattgctcacttgagcttgcaagtggaaaaagctgacagtctcaaagaagac
caaactgtcaaattgtcggttcgagctcactatcaagatggaacgcaagctgtattacca
gctgataaagtaaccttctctacaagtggtgaaggggaagtcgcaattcgtaaaggaatg
cttgagttgcataagccaggagcagtcactctcaaagcggaatatgagggagctaaaggc
caagttgaactcactatccaagccaatactgagaagaagattgcgcaatctatccgtcct
gtaaatgtagtcacagatttgcatcaaaaacctactcttccaacaacagtaacggttgag
tatgacaaaggtttccctaaagctcacaaagtcacttggcaagctattccgaaagaaaaa
ctagactcctatcaaacatttgaagtactaggtaaagttgaaggaattgaccttgaagcg
cgtgcaaaagtctctgtagaaggtatcgtttcagttgaagaagtcagtgtgacaactcca
atcgcagaagcaccacaattaccagaaagtgttcggacatatgattcaaatggtcacgtt
tcatcagctaaggttgcatgggatgcgattcgtccagagcaatacgctaaggaaggtgtc
tttacagttaatggtcgcttagaaggtactcaattaacaactaaacttcatgttcgcgta
tctgctcaaactgagcaaggtgcaaacatttctgaccaatggaccggttcagaattgcca
cttgcctttgcttcagactcaaatccaagcgacccagtttcaaatgttaatgacaagctc
atttcctacaataaccaaccagccaatcgttggacaaactggaatcgtactaatccagaa
gcttcagtcggtgtcctattcggagattcaggtattttgagcaaacgttcagttgataac
ttaagcgttggcttccatgaagaccatggagttggtgcaccgaagtcttatgtgattgag
tattatgttggtaagactgtcccaacagctcctaaaaaccctagttttgttggtaatgag
gaccatgtctttaatgattctgccaactggaaaccagttactaatctaaaagcccctgct
caactcaaggctggagaaatgaaccactttagctttgataaagttgaaacctatgctgtt
cgtattcgcatggtgagagcagacaacaaactaggaacgtctatcacagaggtacaaatc
tttgcgaaacaagttgcggcagccaagcaaggacaaacaagaatccaagttgacggtaaa
gacttagcaaacttcaaccctgatttgacagactactaccttgagtctgtagatggaaaa
gttacggcagtcacagcaagtgttagcaacaatggcctcgctaccgtcgttccaagcgtt
cgtgaaggtgagccggttcgtgtcatcgcgaaagctgaaaatggcgacatcttaggagaa
taccgtctgcacttcactaaggataagaacttactttctcataaaccagttgctgcggtt
aaacaagctcgcttgctacaagtaggtcaagcacttgaattgccgactaaggttccagtt
tacttcacaggtaaagacggctacgaaacaaaaaacctgacagttgaatgggaagaagtt
ccagcggaaaatctgataaaagcaggtcaatttaccgttcgaggccatgtccttggtagt
gatcttgttgctgaggtcactgtacgagtgacagacaaactaggcgaagctctttcagat
aaccctaactatgatgaaaacagtaaccaggcctttgcttcagcaaccaatgatattgac
aaaaactctcatgaccgcgttgactatctcaatgacggagatcattcagaaaatcgtcgt
tggacaaactggtctccaacaccatcttctaatccagaagtatcagcgggtgtgatcttc
cgtgaaaatggtaagattgtagaacggactgttgctcaagccaaacttcacttctttgca
gatagtggtacggatgcaccaactaaactcgttttagaacgctatgtcggtccagagttt
gaagtgccaacctactattcaaactaccaagcctacgacgcagaccatccattcaacaat
ccagaaaattgggaagctgtgccttatcgtgcggataaagacatcgcagctggtgatgaa
atcaacgtaacatttaaagctgtcaaagccaaagctatgagatggcgtatggagcgtaaa
gcagataagagcggtgttgcgatgattgagatgaccttccttgcaccaagtgaattgcct
caagaaagcacgcaatcgaagattcttgtagatggaaaagaacttgctgatttcgctgaa
aatcgtcaagactatcaaattacctataaaggtcaacggccaaaagtctcagttgaagaa
aacaatcaagtagcttcaactgtggtagatagtggagaagatagccttccagtacttgtt
cgcctcgtttcagaaagtggaaaacaagtcaaggaataccgtatccagttgactaaggaa
aaaccagtttctgagaagacagttgctgctgtacaagaagatcttccaaaactcgaattt
gttgaaaaagatttggcctacaagacagttgagaaaaaagattcaacactgtatctaggt
gaaactcgtgtagaacaagaaggaaaaactggtaaagaacgtatctttacagcgattaat
cctgatggaagtaaggaagaaaaactccgtgaagtggtagaagctccgacagaccgcatc
gtcttggttggaaccaaaccagtagctcaagaagctaaaaaaccacaagtgtcagaaaaa
gcagatacaaaaccaattgattcaagtgaagctagtcaaactaataaagcccagttacca
aatacaggtagtgcggcaagccaagcagcagtagcagcaggtttagctcttctaggtttg
agtgcaggattagtagttactaaaggtaaaaaagaagactag

DBGET integrated database retrieval system