KEGG   Streptococcus pneumoniae JJA: SPJ_0817Help
Entry
SPJ_0817          CDS       T00873                                 

Gene name
pfkB
Definition
(GenBank) 1-phosphofructokinase
  KO
K00882  1-phosphofructokinase [EC:2.7.1.56]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
sjj00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:sjj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPJ_0817 (pfkB)
Enzymes [BR:sjj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SPJ_0817 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ACO18727
UniProt: C1CDM4
Position
780287..781198
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSIDYIVRLDQVKVGSVNRMDSDDKFAGGKGINVSRVLKRLNIPNTATGFIG
GFTGKFITDTLAEEEIETRFVQVAEDTRINVKIKADQETEINGTGPTVEPVQLEELKAIL
SSLTAEDTVVFAGSSAKNLGNVIYKDLISLTRQTGAQVVCDFEGQTLIDSLDYQPLLVKP
NNHELGAIFGVKLESLDEIEKYARELLAKGAQNVIISMAGDGALLVTSEGAYFAKPIKGT
VKNSVGAGDSMVAGFTGEFVKSKDAVEAFKWGVACGTATTFSDDLATAEFIKETYGKVEV
EKR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtcacactcaatccatccattgactatatcgttcgtttggaccaagtc
aaagttggtagtgtaaatcgtatggacagtgatgataagtttgctggtgggaaaggaatc
aatgtcagccgtgtcttgaaacgtttgaatataccaaatacagcgacgggatttatcggt
ggctttactggtaaatttatcacagatactttagcagaggaagaaatcgagacacgtttt
gtccaggtggcagaagatactcgtatcaatgttaaaatcaaagcagaccaagaaacagaa
atcaacggaacgggtccaactgttgaaccggttcagctagaagaattgaaagctatttta
tctagtctgacagcagaagatacagttgtctttgcaggttcaagtgctaaaaatctaggc
aatgttatctataaggatttgatttccttgacgcgccagactggtgcgcaagtggtctgt
gactttgaaggacagaccttaattgatagtttggactaccagcctcttcttgtaaaacca
aacaatcatgaacttggagcgatttttggggttaaactcgaaagtttagatgaaattgag
aaatacgctcgtgagttactggctaagggtgctcaaaatgttattatctctatggctggt
gatggcgcccttcttgtcacatctgagggagcttacttcgctaaaccaatcaaaggaaca
gtcaaaaattcagttggagctggtgattctatggttgctggattcacaggtgaatttgtc
aaatcaaaagacgcagtagaagccttcaaatggggagtggcttgcggaacggcaactacc
ttctcagatgacttggcaacggcggaatttattaaagaaacatatggaaaagttgaggta
gaaaaaagatga

DBGET integrated database retrieval system