KEGG   Streptococcus pneumoniae JJA: SPJ_1480Help
Entry
SPJ_1480          CDS       T00873                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
sjj00010  Glycolysis / Gluconeogenesis
sjj00051  Fructose and mannose metabolism
sjj00562  Inositol phosphate metabolism
sjj01100  Metabolic pathways
sjj01110  Biosynthesis of secondary metabolites
sjj01120  Microbial metabolism in diverse environments
sjj01130  Biosynthesis of antibiotics
sjj01200  Carbon metabolism
sjj01230  Biosynthesis of amino acids
Module
sjj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sjj_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sjj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPJ_1480 (tpiA)
   00051 Fructose and mannose metabolism
    SPJ_1480 (tpiA)
   00562 Inositol phosphate metabolism
    SPJ_1480 (tpiA)
Enzymes [BR:sjj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPJ_1480 (tpiA)
Exosome [BR:sjj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPJ_1480 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPJ_1480 (tpiA)
  Exosomal proteins of melanoma cells
   SPJ_1480 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACO19276
UniProt: C1CFF7
Structure
PDB: 

Jmol
Position
complement(1408954..1409712)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
atcgctgctccagctcttgatttgacaactgttcttgctgttgcaaaaggctcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttagctttgcttgactttgtaaaataa

DBGET integrated database retrieval system