KEGG   Streptococcus pneumoniae JJA: SPJ_1494Help
Entry
SPJ_1494          CDS       T00873                                 

Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sjj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SPJ_1494
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPJ_1494
Enzymes [BR:sjj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SPJ_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421296..1422639
Genome map
AA seq 447 aa AA seqDB search
MNLKTTLGLLAGRSSHFVLSRLGRGSTLPGKVALQFDKDILQSLAKNYEIVVVTGTNGKT
LTTALTVGILKEVYGQVLTNPSGANMITGIATTFLTAKSSKTGKNIAVLEIDEASLSRIC
DYIQPSLFVITNIFRDQMDRFGEIYTTYNMILDAIRKVPTATVLLNGDSPLFYKPTIPNP
IEYFGFDLEKGPAQLAHYNTEGILCPDCQGILKYEHNTYANLGAYICEGCGCKRPDLDYR
LTKLVELTNNRSRFVIDGQEYGIQIGGLYNIYNALAAVAIARFLGADSQLIKQGFDKSRA
VFGRQETFHIGDKECTLVLIKNPVGATQAIEMIKLAPYPFSLSVLLNANYADGIDTSWIW
DADFEQITDMDIPEINAGGVRHSEIARRLRVTGYPAEKITETSNLEQVLKTIENQDCKHA
YILATYTAMLEFRELLASRQIVRKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaaaactactttgggccttcttgctgggcgttcttcccacttcgttttaagc
cgtcttggacgtggaagtacgctcccagggaaagtcgcccttcaatttgataaagatatt
ttacaaagcctagctaagaactacgagattgtcgttgtcactggaacaaatggaaaaacc
ctgacaactgccctcactgtcggcattttaaaagaggtttatggtcaagttctaaccaac
ccaagcggtgccaacatgattacagggattgcaacaaccttcctaacagccaaatcttca
aaaactgggaaaaatattgccgtcctcgaaattgacgaagccagtctatctcgtatctgt
gactatatccagcctagtctttttgtcattactaatatcttccgtgaccagatggaccgt
ttcggtgaaatctatactacctataacatgatattggatgccattcgaaaagttccaact
gctactgttctccttaacggagacagtccacttttctacaagccaactattccaaaccct
atagagtattttggttttgacttggaaaaaggaccagcccaacttgctcactacaatacc
gaagggattctctgtcctgactgccaaggcatcctcaaatatgagcataatacctatgca
aacttgggtgcctatatctgtgaaggttgtggatgtaaacgtcctgatctcgactatcgt
ttgacaaaactggttgagttgaccaacaatcgctctcgctttgtcatagacggccaagaa
tacggtatccaaatcggcgggctctataatatctataacgccctagctgctgtggccatc
gcccgtttcctcggcgcagattcccaactcatcaaacagggatttgacaagagccgtgct
gtctttggacgccaagaaacctttcatatcggtgacaaggaatgtacccttgtcttgatt
aaaaatccagtcggtgcaacccaagctatcgaaatgatcaaactagcaccttatccattt
agcctatctgtcctccttaatgccaactatgcagatggaattgacactagctggatctgg
gatgcagactttgagcaaatcactgacatggacattcctgaaatcaacgctggcggtgtt
cgtcattctgaaatcgctcgtcgcctccgagtgactggctatccagctgagaaaatcact
gaaacgagtaatctggagcaagttctcaagaccattgagaatcaagactgcaagcatgcc
tatattctggcaacttatactgccatgctggaatttcgtgaactgctggctagtcgtcag
attgttagaaaggagatgaactaa

DBGET integrated database retrieval system