KEGG   Streptococcus pneumoniae JJA: SPJ_1551Help
Entry
SPJ_1551          CDS       T00873                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (phosphoglyceromutase) (pgam) (bpg-dependent pgam) (dpgm)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sjj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPJ_1551
  Energy metabolism
   00680 Methane metabolism
    SPJ_1551
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPJ_1551
Enzymes [BR:sjj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPJ_1551
Membrane trafficking [BR:sjj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPJ_1551
Exosome [BR:sjj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPJ_1551
  Exosomal proteins of melanoma cells
   SPJ_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1471750..1472442)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPNMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgacttgtctgaaaaaggtacacaacaagcgattgacgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gcgatcaaaacaactaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactatggtggtttgactggtaaaaacaaagctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaacatggaccgtgatgatgagcactcagctcacacagaccgtcgttatgcttca
cttgacgactcagtaatcccagatgctgaaaacttgaaagtgactttggaacgtgccctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaaggtttgtcagatgacgaa
atcatggacgtggaaatccctaacttcccaccattggtattcgaatttgacgaaaaattg
aacgtcgtttctgaatactaccttggaaaataa

DBGET integrated database retrieval system