KEGG   Streptococcus pneumoniae JJA: SPJ_1719Help
Entry
SPJ_1719          CDS       T00873                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sjj  Streptococcus pneumoniae JJA
Pathway
sjj00260  Glycine, serine and threonine metabolism
sjj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sjj01100  Metabolic pathways
sjj01110  Biosynthesis of secondary metabolites
sjj01130  Biosynthesis of antibiotics
sjj01230  Biosynthesis of amino acids
Module
sjj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sjj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPJ_1719 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPJ_1719 (trpA)
Enzymes [BR:sjj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPJ_1719 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: ACO19880
UniProt: C1CG41
Structure
PDB: 

Jmol
Position
complement(1643783..1644559)
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLDGLGETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQALVETLKTIETEIPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLADTDIALIPLVSLTTGIERQKELIEGAEGFVYAVAIN
GVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQADLERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIKQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattaaatgctataaaagcagctggaaaaggaattttt
gttccctatatcatggctggagaccacgagaaaggtttggatggactaggagaaacaatc
cactttctagaagatttgggtgtctctgcaattgaagtgggtattcccttttcagaccct
gttgcagatggacctgttatcgaagaagctggcttgcgcagtttagcccacgggacctct
acccaggctttagttgaaaccttgaaaaccattgaaacagagattccactggtcatcatg
acctacttcaaccccctctttcagtacggtgtggagaactttgtcaaagatctggctgat
acagctgtgaagggcttgattatcccagacttgcctcatgaacatgccaactttgtagaa
ccatttttggcagatacagatatcgccttgattcctttagtaagcttgaccacaggaatt
gagcgccagaaagagttgattgaaggggcggagggattcgtctatgccgttgccatcaat
ggggtaacagggaaatcaggcaattaccgtgcagatttggacaagcacttggcgcaactt
catcaagtggccgacatcccagtcttgacaggttttggtgtatctagtcaagccgatctg
gaacgcttcaatgcggtgtcagatggtgttatcgtcggttcgaaaatagtaaaagctctc
caccaaggagagccgattcaggactttatcaaacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system